BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000190-TA|BGIBMGA000190-PA|undefined (99 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 22 4.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 21 8.3 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 21.8 bits (44), Expect = 4.8 Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 49 RQPVDYVPGPLAVVNAGMVTASTVKTYVSVV 79 R P+ V GPL +V T T+ Y S++ Sbjct: 94 RVPLIKVAGPLIIVQLLETTLLTLVNYASLM 124 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.0 bits (42), Expect = 8.3 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Query: 46 CDMRQPVDYVP----GPLAVVNAGMVTASTVKTY 75 CD+RQ + YV GP VV + A T + + Sbjct: 824 CDVRQLITYVKGAHGGPFRVVALSGILAVTPRPH 857 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.326 0.139 0.444 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,764 Number of Sequences: 2123 Number of extensions: 1576 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 99 length of database: 516,269 effective HSP length: 55 effective length of query: 44 effective length of database: 399,504 effective search space: 17578176 effective search space used: 17578176 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -