Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000190-TA|BGIBMGA000190-PA|undefined
         (99 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g61550.1 68418.m07724 protein kinase family protein contains ...    25   8.5  

>At5g61550.1 68418.m07724 protein kinase family protein contains
          Pfam profile: PF00069 Eukaryotic protein kinase domain;
          protein kinase 1, PnPK1, Populus nigra, EMBL:AB041503
          Length = 845

 Score = 25.0 bits (52), Expect = 8.5
 Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 1/40 (2%)

Query: 43 FTICDMRQPVDYVPGPLAV-VNAGMVTASTVKTYVSVVGW 81
          F +  +R PV Y+P P+ + V    +    V  Y   + W
Sbjct: 53 FKLLYVRPPVSYIPTPMGIAVAVSELREDVVSAYKQELDW 92


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.326    0.139    0.444 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,391,777
Number of Sequences: 28952
Number of extensions: 28367
Number of successful extensions: 48
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 48
Number of HSP's gapped (non-prelim): 1
length of query: 99
length of database: 12,070,560
effective HSP length: 70
effective length of query: 29
effective length of database: 10,043,920
effective search space: 291273680
effective search space used: 291273680
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 52 (25.0 bits)