SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000190-TA|BGIBMGA000190-PA|undefined
         (99 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF078157-6|AAQ62458.1|  406|Caenorhabditis elegans Hypothetical ...    25   9.0  

>AF078157-6|AAQ62458.1|  406|Caenorhabditis elegans Hypothetical
           protein F25E5.6b protein.
          Length = 406

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 43  FTICDMRQPVDYVPGPLAVVNAGMVTASTVKTYVSVV 79
           FT+      + +  G LA +N GMV A TV +   ++
Sbjct: 264 FTVAKKFDTIIHPDGSLAPMNKGMVYAETVMSMAPLI 300


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.326    0.139    0.444 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,444,902
Number of Sequences: 27539
Number of extensions: 29960
Number of successful extensions: 47
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 46
Number of HSP's gapped (non-prelim): 1
length of query: 99
length of database: 12,573,161
effective HSP length: 70
effective length of query: 29
effective length of database: 10,645,431
effective search space: 308717499
effective search space used: 308717499
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -