BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000186-TA|BGIBMGA000186-PA|IPR000571|Zinc finger, CCCH-type (256 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 26 0.39 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 24 1.6 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 2.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 3.6 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 3.6 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 3.6 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 6.3 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 6.3 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 6.3 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 6.3 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 6.3 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 6.3 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 6.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.3 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 8.3 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 8.3 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 8.3 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 8.3 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 8.3 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 8.3 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 25.8 bits (54), Expect = 0.39 Identities = 21/82 (25%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Query: 170 NLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKH--GWQLEREELETPGQDGD 227 N+RA V Y D+ K+Y G C +D+ W ++ E PG D D Sbjct: 96 NVRAVVAQYYDTDVNKEYAIRGNSAIL-KCVVPSFVADFVKVLSWHTDQGEEFVPGDDYD 154 Query: 228 SDYEIHSDEELPFKCFVCREGF 249 Y + EL + +G+ Sbjct: 155 GKYLVLPSGELHIRDVGPEDGY 176 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 23.8 bits (49), Expect = 1.6 Identities = 21/90 (23%), Positives = 42/90 (46%), Gaps = 7/90 (7%) Query: 64 KKSKIDVIEDNDDSNDEEKTSQ-RTTLSVQQQR-----ENATATYELDTEKDRDAQAIFE 117 K + + + + + EE+TS+ R + S ++++ EN+ Y +T K+R Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR-ETSKERSRDRKER 73 Query: 118 KAQKINEELHGQADDKIYRGINNYAQYYKK 147 + K + + +++ Y NNY Y KK Sbjct: 74 ERSKEPKIISSLSNNYKYSNYNNYNNYNKK 103 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/61 (19%), Positives = 27/61 (44%) Query: 71 IEDNDDSNDEEKTSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELHGQA 130 IE + + + + TS + S ++ ++ Y + RD + K + E+LH + Sbjct: 200 IEKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK 259 Query: 131 D 131 + Sbjct: 260 E 260 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/61 (19%), Positives = 27/61 (44%) Query: 71 IEDNDDSNDEEKTSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELHGQA 130 IE + + + + TS + S ++ ++ Y + RD + K + E+LH + Sbjct: 200 IEKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK 259 Query: 131 D 131 + Sbjct: 260 E 260 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/61 (18%), Positives = 28/61 (45%) Query: 71 IEDNDDSNDEEKTSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELHGQA 130 IE +++ + + TS + + ++ ++ Y + RD + K + E+LH + Sbjct: 189 IEKSENESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK 248 Query: 131 D 131 + Sbjct: 249 E 249 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 3.6 Identities = 15/82 (18%), Positives = 35/82 (42%), Gaps = 3/82 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 197 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLH 256 Query: 128 GQADDKIYRGINNYAQYYKKKD 149 + +K ++ +Y + ++ Sbjct: 257 NE-KEKFLEERTSHKRYSRSRE 277 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/61 (18%), Positives = 28/61 (45%) Query: 71 IEDNDDSNDEEKTSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELHGQA 130 IE + + + + TS + S ++ ++ Y + RD +++ + E+LH + Sbjct: 200 IEKSGNESKKYATSSNSLRSRTHDFQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEK 259 Query: 131 D 131 + Sbjct: 260 E 260 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/18 (50%), Positives = 11/18 (61%), Gaps = 1/18 (5%) Query: 232 IHSDEELPFKCFVCREGF 249 IH+ E P+KC VC F Sbjct: 141 IHTKER-PYKCDVCERAF 157 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 6.3 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 186 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLH 245 Query: 128 GQAD 131 + + Sbjct: 246 NEKE 249 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 6.3 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 197 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLH 256 Query: 128 GQAD 131 + + Sbjct: 257 NEKE 260 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 6.3 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 197 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEKLH 256 Query: 128 GQAD 131 + + Sbjct: 257 NEKE 260 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/61 (18%), Positives = 27/61 (44%) Query: 71 IEDNDDSNDEEKTSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELHGQA 130 IE + + + + TS + + ++ ++ Y + RD + K + E+LH + Sbjct: 200 IEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEK 259 Query: 131 D 131 + Sbjct: 260 E 260 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/61 (18%), Positives = 27/61 (44%) Query: 71 IEDNDDSNDEEKTSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELHGQA 130 IE + + + + TS + + ++ ++ Y + RD + K + E+LH + Sbjct: 205 IEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEK 264 Query: 131 D 131 + Sbjct: 265 E 265 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/59 (18%), Positives = 27/59 (45%) Query: 71 IEDNDDSNDEEKTSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELHGQ 129 IE + + + + TS + + ++ ++ Y + RD ++K + E+LH + Sbjct: 200 IEKSGNESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRDRNREYKKKDRRYEKLHNE 258 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 6.3 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 197 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSRYSRERSCSRDRNREYRKKDRRYEKLH 256 Query: 128 GQAD 131 + + Sbjct: 257 NEKE 260 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 103 ELDTEKDRDAQAIFEKAQKINEEL 126 EL +D + I A+KI EEL Sbjct: 839 ELSLRSVKDRETIISAAEKIAEEL 862 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/64 (18%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + + ++ ++ Y + RD + K + E+LH Sbjct: 197 VVNIKKSGNESKKYATSSNSLRNRTHDFQHTSSRYSRERRCSRDRNREYRKKDRQYEKLH 256 Query: 128 GQAD 131 + + Sbjct: 257 NEKE 260 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 197 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLH 256 Query: 128 GQAD 131 + + Sbjct: 257 NEKE 260 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 197 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLH 256 Query: 128 GQAD 131 + + Sbjct: 257 NEKE 260 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 197 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLH 256 Query: 128 GQAD 131 + + Sbjct: 257 NEKE 260 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 197 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLH 256 Query: 128 GQAD 131 + + Sbjct: 257 NEKE 260 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Query: 70 VIEDNDDSNDEEK--TSQRTTLSVQQQRENATATYELDTEKDRDAQAIFEKAQKINEELH 127 V+ N+ +K TS + S ++ ++ Y + RD + K + E+LH Sbjct: 186 VVNIKKSGNESKKYATSSNSLRSRTHGFQHTSSHYSRERSCSRDRNREYRKKDRRYEKLH 245 Query: 128 GQAD 131 + + Sbjct: 246 NEKE 249 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.311 0.130 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,866 Number of Sequences: 429 Number of extensions: 3252 Number of successful extensions: 27 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 22 length of query: 256 length of database: 140,377 effective HSP length: 56 effective length of query: 200 effective length of database: 116,353 effective search space: 23270600 effective search space used: 23270600 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -