GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000182-TA|BGIBMGA000182-PA|IPR011701|Major facilitator
superfamily MFS_1, IPR007114|Major facilitator superfamily
         (474 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5 prot...    24   2.0  

>AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5
           protein.
          Length = 533

 Score = 24.2 bits (50), Expect = 2.0
 Identities = 9/30 (30%), Positives = 15/30 (50%)

Query: 318 WKNIGCCLTWFILGLSFYGSNQYIGQTSPN 347
           W + GC     I+G+ FYG    +  ++ N
Sbjct: 252 WVDYGCSPKKLIVGIPFYGRTFTLSNSNTN 281


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.325    0.138    0.427 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 110,292
Number of Sequences: 317
Number of extensions: 4574
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 2
length of query: 474
length of database: 114,650
effective HSP length: 59
effective length of query: 415
effective length of database: 95,947
effective search space: 39818005
effective search space used: 39818005
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 45 (22.2 bits)