BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000181-TA|BGIBMGA000181-PA|IPR007110|Immunoglobulin- like, IPR008957|Fibronectin, type III-like fold, IPR003599|Immunoglobulin subtype, IPR003598|Immunoglobulin subtype 2, IPR013151|Immunoglobulin (412 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0816 + 7502669-7503145 30 3.9 07_03_0971 + 23038409-23039134,23040321-23040611 29 6.8 02_03_0240 - 16739628-16740369,16740392-16740978 29 6.8 >12_01_0816 + 7502669-7503145 Length = 158 Score = 29.9 bits (64), Expect = 3.9 Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 133 TWVWRAQNISVSAGAVLLLPCSAKGQPTPRISWE 166 TW+W Q V GA +LP + KG R W+ Sbjct: 54 TWLWWRQRGEVDDGAGFVLPLAEKGGAHTRRPWQ 87 >07_03_0971 + 23038409-23039134,23040321-23040611 Length = 338 Score = 29.1 bits (62), Expect = 6.8 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Query: 49 SAASGSYTCEVRAESGELARRTVRIEVHKPPKIADFHFPEE--LEVGGSTQATCSL 102 + ASG + C VR + R I+ H P + HF + + V GS TC + Sbjct: 147 TVASGGFDCTVRIWDVKSGRCVRAIDAHSEP-VTSVHFIRDGSIIVSGSHDGTCKI 201 >02_03_0240 - 16739628-16740369,16740392-16740978 Length = 442 Score = 29.1 bits (62), Expect = 6.8 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 175 RHVLWSQSEASDMGGGSVLSDGTVWLKEVTP-GHEGWYRCTAR 216 R +L ++ D GGG++L+ GT W + P G GW +R Sbjct: 173 RLLLRIKAPDGDDGGGAMLNLGTKWCRSSPPRGEPGWPSSASR 215 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.319 0.133 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,867,731 Number of Sequences: 37544 Number of extensions: 554319 Number of successful extensions: 1073 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 1072 Number of HSP's gapped (non-prelim): 3 length of query: 412 length of database: 14,793,348 effective HSP length: 84 effective length of query: 328 effective length of database: 11,639,652 effective search space: 3817805856 effective search space used: 3817805856 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -