Silkworm BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000179-TA|BGIBMGA000179-PA|undefined
         (179 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_03_0060 - 10511421-10512494                                         27   8.6  

>04_03_0060 - 10511421-10512494
          Length = 357

 Score = 27.1 bits (57), Expect = 8.6
 Identities = 14/45 (31%), Positives = 19/45 (42%)

Query: 123 VHVSSTCGASAGAGEFLVMARRRLGRYSLVCAPRVDDWVQLVLKR 167
           V ++  C    G GE +  +RR  G   LV A R   W     +R
Sbjct: 81  VELAMGCAGGGGGGEAMYSSRRSDGFGGLVVAERRHRWASTAAER 125


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.323    0.137    0.414 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,180,934
Number of Sequences: 37544
Number of extensions: 125443
Number of successful extensions: 268
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 267
Number of HSP's gapped (non-prelim): 1
length of query: 179
length of database: 14,793,348
effective HSP length: 78
effective length of query: 101
effective length of database: 11,864,916
effective search space: 1198356516
effective search space used: 1198356516
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 57 (27.1 bits)