BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000177-TA|BGIBMGA000177-PA|IPR009724|Protein of unknown function DUF1301 (213 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 26 0.23 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.9 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 26.2 bits (55), Expect = 0.23 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Query: 40 YAIKLKEETPIGTEKIYYGTLTPQIKAIK--IFSLCTSIAGIAIQPMLIREASSIGSTSL 97 Y + +EE Y + PQ ++ + +++L T AG+AI L A+ G+T + Sbjct: 7 YLLGSEEEGNQLNRSFYSASYPPQNRSQEEDLWNLATDRAGLAILLFLFSVATVFGNTLV 66 Query: 98 LVAI 101 ++A+ Sbjct: 67 ILAV 70 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Query: 129 YNAETSTYKAITINFFATK 147 YNA ST KAI F TK Sbjct: 271 YNAAVSTTKAINQGFRTTK 289 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,376 Number of Sequences: 429 Number of extensions: 2395 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 213 length of database: 140,377 effective HSP length: 55 effective length of query: 158 effective length of database: 116,782 effective search space: 18451556 effective search space used: 18451556 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -