BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000176-TA|BGIBMGA000176-PA|undefined (295 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 5.6 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 9.9 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/36 (27%), Positives = 18/36 (50%) Query: 185 QQVTDYKYVKRAMEGLSNTDIKLHLEIQGLEGRLSF 220 + +++Y Y + L N D K+ L + E RL + Sbjct: 3 RNISNYSYHDEKFKQLRNEDNKIDLRSRTKEERLQY 38 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 9.9 Identities = 11/41 (26%), Positives = 22/41 (53%) Query: 234 FRTNPQLVLKARPAVGARTLRFTHISNWIEQKLSKEFEKVL 274 F + +LKA+P+ + L + + N ++ L E +K+L Sbjct: 365 FNDSGNPILKAKPSEVVQILGWKELPNVGDEILEVENDKIL 405 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.136 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,580 Number of Sequences: 429 Number of extensions: 2960 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 3 length of query: 295 length of database: 140,377 effective HSP length: 57 effective length of query: 238 effective length of database: 115,924 effective search space: 27589912 effective search space used: 27589912 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -