BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000175-TA|BGIBMGA000175-PA|undefined (455 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73200.1 68414.m08471 expressed protein 63 3e-10 At1g17820.1 68414.m02206 expressed protein 60 4e-09 At1g53590.1 68414.m06088 C2 domain-containing protein 34 0.23 At5g55430.1 68418.m06905 hypothetical protein 31 1.2 At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil... 31 1.2 At3g14590.1 68416.m01847 C2 domain-containing protein low simila... 31 1.2 At3g16460.2 68416.m02097 jacalin lectin family protein contains ... 30 3.7 At3g16460.1 68416.m02098 jacalin lectin family protein contains ... 30 3.7 At1g12230.1 68414.m01415 transaldolase, putative similar to Swis... 29 6.4 At3g47600.1 68416.m05182 myb family transcription factor (MYB94)... 29 8.5 At2g33490.1 68415.m04105 hydroxyproline-rich glycoprotein family... 29 8.5 At2g23310.2 68415.m02783 RER1C protein identical to SP|Q9ZWI7 RE... 29 8.5 At2g23310.1 68415.m02782 RER1C protein identical to SP|Q9ZWI7 RE... 29 8.5 At1g71270.1 68414.m08225 Vps52/Sac2 family protein similar to SP... 29 8.5 At1g28240.1 68414.m03466 expressed protein 29 8.5 >At1g73200.1 68414.m08471 expressed protein Length = 779 Score = 63.3 bits (147), Expect = 3e-10 Identities = 28/96 (29%), Positives = 49/96 (51%) Query: 257 VKRAMEGLSNTDIKLHLEIQGLEGRLSFNLPPPPHDRVWIGFRTNPQLVLKARPAVGART 316 +K +E +S I L + + L G L ++ PPP D++W GF + P + +VG Sbjct: 508 LKNIVEQVSQVPITLSIGVSSLRGTLCVHMKPPPSDQLWFGFTSMPDIEFNLVSSVGEHK 567 Query: 317 LRFTHISNWIEQKLSKEFEKVLVLPNMEDIIIDIMT 352 + +H++ ++ + V+VLPN E + I MT Sbjct: 568 ITNSHVAMFLVNRFKTAIRDVMVLPNCESVTIPWMT 603 Score = 29.5 bits (63), Expect = 4.8 Identities = 23/95 (24%), Positives = 43/95 (45%), Gaps = 9/95 (9%) Query: 90 SDSSGPDDKSNDTNENKDGIELAVYKFSEKDTVAFAKT---SPKSPSPDCECRTLPAELT 146 S S+G KS +D I E D +++ S + D E ++ Sbjct: 282 SQSTGSSGKSTSARRMQDNIP------EETDVQVISRSWSHSSHASDVDSEDKSFDEGTL 335 Query: 147 WVNTALARVAYDVMRDPVIIARVQNRIQRKLNTLK 181 +N L+R+ +DV ++ V+ V+ RIQR ++ ++ Sbjct: 336 ALNVVLSRLFFDVKQNTVLKNLVRERIQRIMSNMR 370 >At1g17820.1 68414.m02206 expressed protein Length = 803 Score = 59.7 bits (138), Expect = 4e-09 Identities = 26/95 (27%), Positives = 47/95 (49%) Query: 257 VKRAMEGLSNTDIKLHLEIQGLEGRLSFNLPPPPHDRVWIGFRTNPQLVLKARPAVGART 316 +K E +S I L + + L G L ++ PPP D++W GF + P + +VG Sbjct: 505 LKTIAEQVSQVPISLSIRVSSLRGTLRVHMKPPPSDQLWFGFTSMPDIEFDLASSVGEHK 564 Query: 317 LRFTHISNWIEQKLSKEFEKVLVLPNMEDIIIDIM 351 + +H++ ++ + + +VLPN E + I M Sbjct: 565 ITNSHVAMFLINRFKTAIREAVVLPNCESLTIPWM 599 >At1g53590.1 68414.m06088 C2 domain-containing protein Length = 751 Score = 33.9 bits (74), Expect = 0.23 Identities = 39/147 (26%), Positives = 64/147 (43%), Gaps = 16/147 (10%) Query: 270 KLHLEIQGLEGRL----SFNLPPPPHDRVWIGFRTNPQLVLKARPAV--GARTLRFTHIS 323 KLHL +EG++ F P R+ + F P + +P G I+ Sbjct: 177 KLHLTGMHVEGKVLIGVKFLRRWPFLGRLRVCFAEPPYFQMTVKPIFTHGLDVAVLPGIA 236 Query: 324 NWIEQKLSKEFEKVLVLPNMEDIIIDI---MTPTPVQFEFRRLSTAIAEANAASSDSSGP 380 W+++ LS FE+ LV PNM +++D+ ++PT + F +A ++S Sbjct: 237 GWLDKLLSIAFEQTLVQPNM--LVVDMEKFVSPTSENWFFVDEKEPVAHVLVEVFEAS-- 292 Query: 381 DDKSNDTNENKDGI---ELAVYKFSEK 404 D K +D N D +L Y+F K Sbjct: 293 DLKPSDLNGLADPYVKGKLGAYRFKTK 319 >At5g55430.1 68418.m06905 hypothetical protein Length = 149 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 15 DEDIDENELSKIKEFLEEAEMETGADGTAEGEW 47 D+D++E E K +E +EE E E + EGEW Sbjct: 15 DDDLEEEEDEKEEEEVEEEEEEEEEEEDEEGEW 47 >At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 2228 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/35 (42%), Positives = 18/35 (51%) Query: 12 DDMDEDIDENELSKIKEFLEEAEMETGADGTAEGE 46 DD D + E +S +E LEEA ETG T E Sbjct: 483 DDEDMKVSETHVSVERELLEEAHQETGEKSTVADE 517 >At3g14590.1 68416.m01847 C2 domain-containing protein low similarity to SP|Q16974 Calcium-dependent protein kinase C (EC 2.7.1.-) {Aplysia californica}; contains Pfam profile PF00168: C2 domain Length = 737 Score = 31.5 bits (68), Expect = 1.2 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 8/87 (9%) Query: 270 KLHLEIQGLEGRL----SFNLPPPPHDRVWIGFRTNPQLVLKARPAV--GARTLRFTHIS 323 KLHL +EG++ F P R+ + F P + +P G I+ Sbjct: 177 KLHLTGMHVEGKVLIGVKFLRRWPFLGRLRVCFAEPPYFQMTVKPITTHGLDVAVLPGIA 236 Query: 324 NWIEQKLSKEFEKVLVLPNMEDIIIDI 350 W+++ LS FE+ LV PNM +++D+ Sbjct: 237 GWLDKLLSVAFEQTLVEPNM--LVVDM 261 >At3g16460.2 68416.m02097 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 647 Score = 29.9 bits (64), Expect = 3.7 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 2/91 (2%) Query: 354 TPVQFEFRRLSTAIAEANAASSDSSGPDDKSNDTNENKDGIELAVYKFSEKDTVAFA-KT 412 TPV +L+ E A D S D K + +DG+ +++ V F + Sbjct: 400 TPVPSTPLKLTAEGGETGAVWDDGSHDDVKKVYVGQGQDGVAAVKFEYKNGSQVVFGDER 459 Query: 413 SNKSDTGSEGVTISSLGQTLPSDSEAYEKNF 443 ++ G E + S + + S YEKNF Sbjct: 460 GTRTLLGFEEFELES-DEYITSVEGYYEKNF 489 >At3g16460.1 68416.m02098 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 705 Score = 29.9 bits (64), Expect = 3.7 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 2/91 (2%) Query: 354 TPVQFEFRRLSTAIAEANAASSDSSGPDDKSNDTNENKDGIELAVYKFSEKDTVAFA-KT 412 TPV +L+ E A D S D K + +DG+ +++ V F + Sbjct: 400 TPVPSTPLKLTAEGGETGAVWDDGSHDDVKKVYVGQGQDGVAAVKFEYKNGSQVVFGDER 459 Query: 413 SNKSDTGSEGVTISSLGQTLPSDSEAYEKNF 443 ++ G E + S + + S YEKNF Sbjct: 460 GTRTLLGFEEFELES-DEYITSVEGYYEKNF 489 >At1g12230.1 68414.m01415 transaldolase, putative similar to Swiss-Prot:P30148 transaldolase B (EC 2.2.1.2) [Escherichia coli O157:H7] Length = 405 Score = 29.1 bits (62), Expect = 6.4 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Query: 351 MTPTP-VQFEFRRLSTAIAEANAASSDSSGPDDKSNDTNENKDGIELAVYKFSEKDTVAF 409 +TP P V F RR +I A++S SS P S + EN + ++ + DTV F Sbjct: 31 VTPLPAVNFSLRR---SIPRILASASSSSSPASSSLEAGENNELNAVSAFSEIVPDTVVF 87 >At3g47600.1 68416.m05182 myb family transcription factor (MYB94) contains Pfam profile: PF00249 myb-like DNA-binding domain; identical to cDNA putative transcription factor (MYB94) GI:3941527 Length = 333 Score = 28.7 bits (61), Expect = 8.5 Identities = 19/64 (29%), Positives = 24/64 (37%) Query: 71 KHEWFRRLSTAIAEANAASSDSSGPDDKSNDTNENKDGIELAVYKFSEKDTVAFAKTSPK 130 K +W RRL T I A A D+ D N TN + + S T T Sbjct: 153 KGQWERRLQTDINMAKQALCDALSIDKPQNPTNFSIPDLGYGPSSSSSSTTTTTTTTRNT 212 Query: 131 SPSP 134 +P P Sbjct: 213 NPYP 216 >At2g33490.1 68415.m04105 hydroxyproline-rich glycoprotein family protein Common family member:At3g26910 [Arabidopsis thaliana] Length = 623 Score = 28.7 bits (61), Expect = 8.5 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Query: 376 DSSGPDD---KSNDTNENKDGIELAV-YKFSEKDTVAFAKTSNKSDTGSEGVTISSLG 429 D G D+ ND +E D EL+ Y+ ++KD A + S+ G+ +T +G Sbjct: 245 DDDGDDEIENNENDGSEVHDDGELSFEYRVNDKDQDADSSAGGSSELGNSDITFPQIG 302 >At2g23310.2 68415.m02783 RER1C protein identical to SP|Q9ZWI7 RER1C protein (AtRER1C) {Arabidopsis thaliana} Length = 211 Score = 28.7 bits (61), Expect = 8.5 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query: 79 STAIAEANAASSDSSGPDD--KSNDTNENKDGIELAVYKFSEKDTVAFAKTSP 129 +TA+ AA++ ++ DD +S+D++ D + ++ FS++ KT P Sbjct: 5 ATAVVPPAAAATTATATDDNLQSSDSSSPADAVNRLIHAFSQRQQHLLDKTVP 57 >At2g23310.1 68415.m02782 RER1C protein identical to SP|Q9ZWI7 RER1C protein (AtRER1C) {Arabidopsis thaliana} Length = 212 Score = 28.7 bits (61), Expect = 8.5 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query: 79 STAIAEANAASSDSSGPDD--KSNDTNENKDGIELAVYKFSEKDTVAFAKTSP 129 +TA+ AA++ ++ DD +S+D++ D + ++ FS++ KT P Sbjct: 5 ATAVVPPAAAATTATATDDNLQSSDSSSPADAVNRLIHAFSQRQQHLLDKTVP 57 >At1g71270.1 68414.m08225 Vps52/Sac2 family protein similar to SP|P39904 SAC2 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04129: Vps52 / Sac2 family Length = 707 Score = 28.7 bits (61), Expect = 8.5 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 2/87 (2%) Query: 327 EQKLSKEFEKVLVLPNMEDIIID--IMTPTPVQFEFRRLSTAIAEANAASSDSSGPDDKS 384 E KL+K E ++V P M D+I+D + E EA+ A S D Sbjct: 157 ESKLAKFVEDIIVPPKMIDVIVDGEVNEEYMKTLEILSKKLKFVEADQAVKSSKALKDVE 216 Query: 385 NDTNENKDGIELAVYKFSEKDTVAFAK 411 + + + VY F + +A K Sbjct: 217 PELEKLRQKAISKVYDFIVQKLIALRK 243 >At1g28240.1 68414.m03466 expressed protein Length = 581 Score = 28.7 bits (61), Expect = 8.5 Identities = 15/30 (50%), Positives = 15/30 (50%) Query: 283 SFNLPPPPHDRVWIGFRTNPQLVLKARPAV 312 SF LPPPP DR G R P L AV Sbjct: 150 SFTLPPPPADRKRTGPRPCPVCYLPVEEAV 179 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.313 0.130 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,742,674 Number of Sequences: 28952 Number of extensions: 389055 Number of successful extensions: 1209 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 9 Number of HSP's that attempted gapping in prelim test: 1193 Number of HSP's gapped (non-prelim): 25 length of query: 455 length of database: 12,070,560 effective HSP length: 83 effective length of query: 372 effective length of database: 9,667,544 effective search space: 3596326368 effective search space used: 3596326368 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -