BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000173-TA|BGIBMGA000173-PA|IPR003123|Vacuolar sorting protein 9, IPR002110|Ankyrin (896 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 29 0.19 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 26 1.3 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 24 4.0 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 24 4.0 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 24 4.0 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 7.0 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 28.7 bits (61), Expect = 0.19 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 784 CNILIFNRANVNCRNKKAQTP-LHLAAINNKTVVIRLLLDNGANINAI 830 CN+L + NK ++ + + I + V+ RLL DN AN N I Sbjct: 126 CNVLTVFKIRYKDLNKALESSKISVGLIRDTAVLYRLLADNVANFNKI 173 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 1 MDGTYDEIVSENPFFLELKNEYANLFQHCLS-ESWIICVPR 40 ++G Y+ I+ P++ E K + N +H LS + VPR Sbjct: 106 LNGIYEYIMRNFPYYRENKQGWQNSIRHNLSLNKCFVKVPR 146 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 351 SGALTGPPDPEAYYYYESNLTEEN 374 +G+ PP P+ YY+ + ++N Sbjct: 51 TGSEETPPSPQEVYYHHQTIPQDN 74 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 351 SGALTGPPDPEAYYYYESNLTEEN 374 +G+ PP P+ YY+ + ++N Sbjct: 51 TGSEETPPSPQEVYYHHQTIPQDN 74 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 351 SGALTGPPDPEAYYYYESNLTEEN 374 +G+ PP P+ YY+ + ++N Sbjct: 51 TGSEETPPSPQEVYYHHQTIPQDN 74 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 23.4 bits (48), Expect = 7.0 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 782 EFCNILIFNRANVNCRNKKAQTPLH 806 +FC LI+ A +N KAQ PL+ Sbjct: 48 QFCTHLIYGYAGINAETFKAQ-PLN 71 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.133 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,327 Number of Sequences: 317 Number of extensions: 8626 Number of successful extensions: 42 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 36 Number of HSP's gapped (non-prelim): 6 length of query: 896 length of database: 114,650 effective HSP length: 63 effective length of query: 833 effective length of database: 94,679 effective search space: 78867607 effective search space used: 78867607 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -