BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000172-TA|BGIBMGA000172-PA|IPR012337|Polynucleotidyl transferase, Ribonuclease H fold (285 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces po... 33 0.062 SPBC211.02c |cwf3|syf1|complexed with Cdc5 protein Cwf3 |Schizos... 28 1.8 SPAC16C9.06c |upf1||ATP-dependent RNA helicase Upf1|Schizosaccha... 28 1.8 SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein Pop2|Schizosacchar... 27 4.1 SPAC29E6.07 ||SPAC30.11|sequence orphan|Schizosaccharomyces pomb... 26 7.1 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 25 9.4 >SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces pombe|chr 1|||Manual Length = 635 Score = 32.7 bits (71), Expect = 0.062 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Query: 151 TAHVVT-NYVTQDLLDSNAYFHDAFSRSWHYRLAWLFPPPSLIPRVLDHLNSASGRYILV 209 TAH+ T +Y + S F D+FS ++ + P +IPR+ D LN + + + Sbjct: 541 TAHLTTPHYEPLRFICSQVGFDDSFSGD-DKQVVDVVAPSFVIPRLDDILNKIADKPLYS 599 Query: 210 APKWKKPFWRPDLK 223 W+ F RPD K Sbjct: 600 PDDWELYFTRPDGK 613 >SPBC211.02c |cwf3|syf1|complexed with Cdc5 protein Cwf3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 790 Score = 27.9 bits (59), Expect = 1.8 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Query: 151 TAHVVTNYVTQDLLDSNAYFHDAF 174 T VV NY +LL+ NAYF D+F Sbjct: 513 TPQVVVNYA--NLLEENAYFEDSF 534 >SPAC16C9.06c |upf1||ATP-dependent RNA helicase Upf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 925 Score = 27.9 bits (59), Expect = 1.8 Identities = 16/74 (21%), Positives = 38/74 (51%), Gaps = 3/74 (4%) Query: 199 LNSASGRYILVAPKWKKPFWRPDLKTRALRRPVKLRDLSTSLVDTMTMLPPAHVSNLHLE 258 LNS + + P K ++ DL + P++ + ++++ + + LP + S+ +LE Sbjct: 831 LNSLQKFSLTLTPPQKPQKFKRDLNVQRSLSPIQ--NAGSAMLPSFSNLPNLYSSS-YLE 887 Query: 259 AWLILGKYELKSTN 272 W + +Y+ + +N Sbjct: 888 EWNVFAQYKRRESN 901 >SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein Pop2|Schizosaccharomyces pombe|chr 1|||Manual Length = 703 Score = 26.6 bits (56), Expect = 4.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Query: 166 SNAYFHDAFSRSWHYRLAWLFP--PPS 190 S+ YF + F R + R WLFP PPS Sbjct: 315 SDDYFPEIFKRHFLNRKRWLFPSIPPS 341 >SPAC29E6.07 ||SPAC30.11|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 116 Score = 25.8 bits (54), Expect = 7.1 Identities = 9/12 (75%), Positives = 10/12 (83%) Query: 245 TMLPPAHVSNLH 256 T+LPPAH NLH Sbjct: 95 TILPPAHTKNLH 106 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 25.4 bits (53), Expect = 9.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 174 FSRSWHYRLAWLFPPPSLIP 193 +S++ H+ L +LF PP+ P Sbjct: 289 YSKTMHFLLTYLFEPPTSFP 308 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.319 0.133 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,132,683 Number of Sequences: 5004 Number of extensions: 40351 Number of successful extensions: 85 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 82 Number of HSP's gapped (non-prelim): 6 length of query: 285 length of database: 2,362,478 effective HSP length: 72 effective length of query: 213 effective length of database: 2,002,190 effective search space: 426466470 effective search space used: 426466470 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -