BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000170-TA|BGIBMGA000170-PA|IPR011709|Protein of unknown function DUF1605 (160 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domai... 22 8.1 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 22 8.1 >DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 22.2 bits (45), Expect = 8.1 Identities = 6/16 (37%), Positives = 13/16 (81%) Query: 15 SCEDKRKSERACKQWC 30 +C ++RK++ AC++ C Sbjct: 78 TCTNQRKNDSACRRSC 93 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 22.2 bits (45), Expect = 8.1 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Query: 6 FDSYLRVRSSCE---DKRKSERACKQWCQRYRLNHRVLEKAAD 45 + Y+ +R E + + SER K W Q R R +K A+ Sbjct: 236 YTRYITIRRKAELAQNLQLSERQVKIWFQNRRAKDRKQKKKAE 278 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.136 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,918 Number of Sequences: 2123 Number of extensions: 6719 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 160 length of database: 516,269 effective HSP length: 59 effective length of query: 101 effective length of database: 391,012 effective search space: 39492212 effective search space used: 39492212 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -