GeneModel BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000169-TA|BGIBMGA000169-PA|IPR000276|Rhodopsin-like GPCR
superfamily
         (371 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF016424-5|AAB65326.1|  282|Caenorhabditis elegans Hypothetical ...    29   7.0  

>AF016424-5|AAB65326.1|  282|Caenorhabditis elegans Hypothetical
           protein F39G3.4 protein.
          Length = 282

 Score = 28.7 bits (61), Expect = 7.0
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 290 YLAGR-LVTFRSVRFFCATLMWRILNPHSYLHVLSLAVFIDKTWSLLKSVRYIG 342
           YL G  L+++R  RF    +   I   H++LH+ S+ + +   +S++ +++Y G
Sbjct: 109 YLQGEALLSYRVYRFTTNRVSILI---HTFLHIASIVLAVGALFSIILTIKYTG 159


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.328    0.141    0.439 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,930,422
Number of Sequences: 27539
Number of extensions: 300017
Number of successful extensions: 875
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 875
Number of HSP's gapped (non-prelim): 1
length of query: 371
length of database: 12,573,161
effective HSP length: 82
effective length of query: 289
effective length of database: 10,314,963
effective search space: 2981024307
effective search space used: 2981024307
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 60 (28.3 bits)