BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000168-TA|BGIBMGA000168-PA|undefined (693 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 7.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 9.3 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 9.3 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.0 bits (47), Expect = 7.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Query: 336 LKMHPKQVNADQDLLKFGNDNNLPLISNKQN 366 L +HP +++ +Q L ND N+ ++QN Sbjct: 291 LSIHPSKLDVEQMNLLHSNDLNMHQQHHQQN 321 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 9.3 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 171 NNLFDTNDNINSDNLKQLNDFIIQQSHVKS 200 +N F N + N+ NDFIIQ H+ S Sbjct: 568 SNYF-ANKTYDFHNMSFENDFIIQPKHLLS 596 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 9.3 Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Query: 299 IESPENNHAFSKTILFNKYMQKT-PEVNPITNALADYNLKMHPKQVNADQDLLKFGNDNN 357 + +P N++A + L + T P P T+ + NL ++ K G +NN Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQ-NLSSPASSTSSTSSTEKAGTNNN 187 Query: 358 LPLISNKQNQP 368 S N P Sbjct: 188 NSKSSQSSNPP 198 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.132 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,235 Number of Sequences: 317 Number of extensions: 6790 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 3 length of query: 693 length of database: 114,650 effective HSP length: 61 effective length of query: 632 effective length of database: 95,313 effective search space: 60237816 effective search space used: 60237816 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -