GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000167-TA|BGIBMGA000167-PA|IPR004361|Glyoxalase I,
IPR004360|Glyoxalase/bleomycin resistance protein/dioxygenase
         (173 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenin...    24   2.2  

>AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenine
           transaminase protein.
          Length = 396

 Score = 24.2 bits (50), Expect = 2.2
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 3/43 (6%)

Query: 33  IKDPRKTIPFYTGVL---GMTLLKQLHFPAMKFSLFFMGYENP 72
           +KDPR  +P  TG++   G+   K   +    FSL   G   P
Sbjct: 307 VKDPRHRLPTVTGIMIPKGVDWWKVSQYAMNNFSLEVQGGLGP 349


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.321    0.138    0.434 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,167
Number of Sequences: 2123
Number of extensions: 7686
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 173
length of database: 516,269
effective HSP length: 60
effective length of query: 113
effective length of database: 388,889
effective search space: 43944457
effective search space used: 43944457
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)