BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000166-TA|BGIBMGA000166-PA|IPR000618|Insect cuticle protein (492 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:100... 43 5e-04 At2g33850.1 68415.m04155 expressed protein contains 1 transmembr... 36 0.046 At2g39440.1 68415.m04841 expressed protein 35 0.11 At1g75530.1 68414.m08778 forkhead-associated domain-containing p... 33 0.43 At1g03820.1 68414.m00363 expressed protein similar to arabinogal... 33 0.43 At5g27130.1 68418.m03238 MADS-box family protein various predict... 32 0.75 At5g10170.1 68418.m01177 inositol-3-phosphate synthase, putative... 32 0.75 At4g00752.1 68417.m00103 UBX domain-containing protein similar t... 32 0.75 At1g55365.1 68414.m06328 hypothetical protein 31 1.3 At5g28190.1 68418.m03413 hypothetical protein 31 1.7 At4g21440.1 68417.m03099 myb family transcription factor (MYB102... 31 2.3 At3g20860.1 68416.m02637 protein kinase family protein contains ... 30 3.0 At2g04620.1 68415.m00470 cation efflux family protein potential ... 30 3.0 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 30 3.0 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 30 4.0 At5g26980.1 68418.m03219 syntaxin 41 (SYP41) / TLG2a identical t... 30 4.0 At3g03200.1 68416.m00316 no apical meristem (NAM) family protein... 30 4.0 At5g60130.1 68418.m07538 transcriptional factor B3 family protei... 29 5.3 At4g12250.1 68417.m01942 NAD-dependent epimerase/dehydratase fam... 29 5.3 At3g08790.1 68416.m01021 VHS domain-containing protein / GAT dom... 29 5.3 At5g27960.1 68418.m03367 MADS-box protein (AGL90) 29 7.0 At3g58710.1 68416.m06543 WRKY family transcription factor contai... 29 7.0 At1g70370.1 68414.m08095 BURP domain-containing protein / polyga... 29 7.0 At5g48310.1 68418.m05968 expressed protein 29 9.3 At5g26650.1 68418.m03175 MADS-box protein (AGL36) contains inter... 29 9.3 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 29 9.3 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 9.3 At2g27170.1 68415.m06029 structural maintenance of chromosomes (... 29 9.3 >At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:1000090) [Gossypium barbadense] Length = 335 Score = 42.7 bits (96), Expect = 5e-04 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 2/92 (2%) Query: 289 NNFN-NYISTTRSYDDDVINSNKIANNDNDYGLNDYAKLKNQNEYVNYDSKEFYNDDYSS 347 NN+ NY T +Y N+ + NN+N Y N + N NY +EF N++ ++ Sbjct: 129 NNYEENYPKKTENYGTKGYNNEEFNNNNNKYDANFKEEFNNNKYDENYAKEEFNNNNNNN 188 Query: 348 ELNSNYPSYISKFKSFADDKINDNYQVVTSTS 379 N Y + K +SF ++ ++ V S + Sbjct: 189 NYNYKYDENV-KEESFPENNEDNKKNVYNSNA 219 Score = 29.9 bits (64), Expect = 4.0 Identities = 34/146 (23%), Positives = 62/146 (42%), Gaps = 16/146 (10%) Query: 279 DYRKTNYDRGNNFNNYISTTRSYDDDVINSNKIANND----NDYGLNDY-AKLKNQNEYV 333 +Y K ++ NN NNY YD++V + NN+ N Y N Y +L+ + Y Sbjct: 175 NYAKEEFNNNNNNNNY---NYKYDENVKEESFPENNEDNKKNVYNSNAYGTELERETPYK 231 Query: 334 NYDSKEFYNDDYSSELNSNYPSYISKFKSFADDKINDNYQVVTSTSKPNFDDIRNLLIDE 393 Y +N + ++ + S + +D+ + +Y + + P + E Sbjct: 232 GYS----HNLERQGMSDTRFMEKGSYYYDLYNDRNHGHYYRKSHSKSP--AGYYSSPATE 285 Query: 394 KTYNTRQSYNDIEPNSQSTLKDNSYN 419 Y +QSY+ N +++ KD YN Sbjct: 286 TNYE-QQSYSYGNNNEENSFKD-PYN 309 Score = 29.1 bits (62), Expect = 7.0 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 143 NEHKVQNKKPYDYDYKVKSPEYNQHDNEIHDE-NNSDYNHAQNYAFSYTVKDK 194 NE N YD ++K + +N +E NN++ N+ NY + VK++ Sbjct: 149 NEEFNNNNNKYDANFKEEFNNNKYDENYAKEEFNNNNNNNNYNYKYDENVKEE 201 >At2g33850.1 68415.m04155 expressed protein contains 1 transmembrane domain; similar to Protein E6 (Swiss-Prot:Q01197) [Gossypium hirsutum] Length = 267 Score = 36.3 bits (80), Expect = 0.046 Identities = 33/128 (25%), Positives = 52/128 (40%), Gaps = 11/128 (8%) Query: 295 ISTTRSYDDDVINSNKIANNDNDYGLNDYAKLKNQNEYVN---YDSKEFYNDDYSSELNS 351 I T + D N I ++N YGL + N NE +N Y+ Y+D +S+ S Sbjct: 50 IETNEKKEPDDQNPAFIPQSENGYGLYGHETTDNNNEELNNNKYEDNVNYDDSFSTPSLS 109 Query: 352 NYPSYISKFKSFADDKINDNYQVVTSTSKPNFDDIRNLLIDEKTYNTRQSYNDI-EPNSQ 410 +K++ ++Y T N D + + Y T + NDI +P Sbjct: 110 ETAQTQESYKNY-----KESYPKTTEIYDNNKD--TSYYENSNAYGTDKRDNDINDPYKG 162 Query: 411 STLKDNSY 418 + KD SY Sbjct: 163 YSNKDTSY 170 >At2g39440.1 68415.m04841 expressed protein Length = 773 Score = 35.1 bits (77), Expect = 0.11 Identities = 34/152 (22%), Positives = 66/152 (43%), Gaps = 6/152 (3%) Query: 301 YDDDVINSNKIANNDNDYGLNDYAKLKNQNEYVNYDSKEFYNDDYSSELNSNYPSYI-SK 359 Y+D++ +S I ++ D ++ L+NQ E + +S E Y+D E++S+ S + S Sbjct: 543 YEDNLDDSEDILDDSEDLPYPNFLSLENQLETLKSES-ESYSDGSGMEVSSDEESALDSA 601 Query: 360 FKSFADDKINDNYQVVTSTSKPNFDDI-RNLLIDEKTYNTRQSYNDIEPNSQSTLKDNSY 418 K + + S DDI +L+ +K + I P L+ Y Sbjct: 602 IKESKESEPIGFLDTQESRDSSYIDDILAEVLLGDKNCVPGKRDLVITPKIFEKLEKKYY 661 Query: 419 NPVNFKKSN---LYTNIDESIAITPRNFVTNP 447 ++K+S+ L+ ++ S+ +F P Sbjct: 662 TETSWKRSDRKILFDRVNSSLVEILESFSATP 693 >At1g75530.1 68414.m08778 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 555 Score = 33.1 bits (72), Expect = 0.43 Identities = 28/152 (18%), Positives = 58/152 (38%), Gaps = 6/152 (3%) Query: 272 DYINVITDYRKTNYDRGNNFNNYISTTRSYDDDVIN---SNKIANNDNDYGLN--DYAKL 326 D + V T Y T R + + D+ +N N D+D+G D Sbjct: 79 DSVPVRTHYYTTRKRRRLELEESLKVNNNAIDEHLNVEEGNLFGECDDDFGFKFEDIESF 138 Query: 327 KNQNEYVNYDSKEFYNDDYSSELNSNYPSYISKFKSFADDKINDNYQVVTSTSKPNFDDI 386 +N + ++ + +E++ +++ + DD+I+D+Y T T+ + Sbjct: 139 RNTFPDILLSPHDYQTTIFGNEIDDEDDRMVNQMLNINDDQIHDSYVTDTITTTTEHVLL 198 Query: 387 RNLLIDEKTYNTRQSYND-IEPNSQSTLKDNS 417 + + D S N+ P+ Q + D + Sbjct: 199 QEVFQDPLFQQPNASLNEPASPSQQQVILDQA 230 >At1g03820.1 68414.m00363 expressed protein similar to arabinogalactan-protein; AGP (GI:1087015) {Pyrus communis}; similar to Protein E6. (SP:Q01197) {Gossypium hirsutum} Length = 222 Score = 33.1 bits (72), Expect = 0.43 Identities = 18/84 (21%), Positives = 36/84 (42%), Gaps = 3/84 (3%) Query: 282 KTNYDRGNNFNNYISTTRSYDDDVINSNKIANNDNDYGLNDYAKLKNQNEYVNYDSKEFY 341 K Y+ NN N Y TT +Y+D N N + G++D ++N + + + Sbjct: 128 KDKYNNNNNNNGYTYTTNNYND---NGRGYGNEEEKQGMSDTRVMENGKYFYDTRGRNSE 184 Query: 342 NDDYSSELNSNYPSYISKFKSFAD 365 N N+ + ++F++ + Sbjct: 185 NTPSRGYENARGNDHTNEFETMEE 208 >At5g27130.1 68418.m03238 MADS-box family protein various predicted MADS box proteins, Arabidopsis thaliana Length = 306 Score = 32.3 bits (70), Expect = 0.75 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query: 302 DDDVINSNKIANNDNDYGLNDYAKLKNQNEYVNYDSKEF 340 DD++ N ++N+D +GLN Y L N N +N+ +F Sbjct: 265 DDEICFWNDLSNDDV-FGLNSYFGLDNTNAMINFGDSDF 302 >At5g10170.1 68418.m01177 inositol-3-phosphate synthase, putative / myo-inositol-1-phosphate synthase, putative / MI-1-P synthase, putative very strong similarity to SP|Q38862 Myo-inositol-1-phosphate synthase isozyme 2 (EC 5.5.1.4) (MI-1-P synthase 2) (IPS 2) {Arabidopsis thaliana}; identical to SP|Q9LX12| Probable inositol-3-phosphate synthase isozyme 3 (EC 5.5.1.4) (Myo- inositol-1-phosphate synthase 3) (MI-1-P synthase 3) (IPS 3) {Arabidopsis thaliana}; contains Pfam profile PF01658: Myo-inositol-1-phosphate synthase Length = 510 Score = 32.3 bits (70), Expect = 0.75 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 157 YKVKSPEYNQHDNEIH---DENNSDYNHA-QNYAFSYTVKDKDTGDDFSHSQH 205 +KV+SP +NEIH D ++ H +N AF +TVK K +F H Sbjct: 6 FKVESPNVKYTENEIHSVYDYQTTELVHENKNGAFQWTVKPKTVKYEFKTDTH 58 >At4g00752.1 68417.m00103 UBX domain-containing protein similar to Ara4-interacting protein [Arabidopsis thaliana] GI:13160609; contains Pfam profiles PF00789: UBX domain, PF02809: Ubiquitin interaction motif Length = 469 Score = 32.3 bits (70), Expect = 0.75 Identities = 16/71 (22%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Query: 352 NYPSYISKFKSFADDKINDNYQVVTSTSKPNFDDIRNLLIDEKTYNTRQSYNDIEPNSQS 411 +Y S +S A ++ ++ + +F D+ + D+ + +TR YN +E N+ Sbjct: 11 SYMSITGASESLAIQRLEEHGNNLPEAINAHFRDVERSIYDDSSLDTRSDYNVVEDNNH- 69 Query: 412 TLKDNSYNPVN 422 ++ + PVN Sbjct: 70 -VRGSETRPVN 79 >At1g55365.1 68414.m06328 hypothetical protein Length = 126 Score = 31.5 bits (68), Expect = 1.3 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 364 ADDKINDNYQVVTSTSKPNFDDIRNLLIDEKT-YNTRQSYNDIEPNSQSTLKDNSYN 419 +D + Y+ ++++S DD L D YN R Y+D + S S+ D++Y+ Sbjct: 64 SDSFYSYTYETLSASSSSEADDDDRLAFDHNNLYNRRDYYSDDDDQSISSFDDDNYD 120 >At5g28190.1 68418.m03413 hypothetical protein Length = 839 Score = 31.1 bits (67), Expect = 1.7 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Query: 137 PIYRVINEHKVQNKKPYDYDYK--VKSPEYNQHDNEIHDENNSDYNHAQNYAFSYTVKDK 194 PIY V+ + K+ YD D K VK +N N+ D+ S+ + +Y + V D Sbjct: 34 PIYDVVGDDVSSTKRTYDGDPKIGVKDDGFNDVKNDGFDDVVSNAENIDDYFNTQDVDDN 93 Query: 195 D 195 D Sbjct: 94 D 94 >At4g21440.1 68417.m03099 myb family transcription factor (MYB102) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 350 Score = 30.7 bits (66), Expect = 2.3 Identities = 39/167 (23%), Positives = 71/167 (42%), Gaps = 26/167 (15%) Query: 307 NSNKIANNDNDYGLNDYAKLKNQNEYVNYDSKEFYNDDYSSELNSNYPSYISKFKSF--A 364 N N+ D+D + + +Q Y + +++ + + EL S+ P + ++ + F Sbjct: 186 NQNQNLVVDHDSRTQEKQTVYSQTGVNQYQTNQYFENTITQELQSSMPPFPNEARQFNNM 245 Query: 365 DDKIND-NYQVVTSTSKPNFDDIRNLLIDEKTYNTRQSYNDIEPNSQSTLKDNSYNPVNF 423 D N Q + STS + D N S+ND +S + + D SY+ +F Sbjct: 246 DHHFNGFGEQNLVSTSTTSVQDCYN-----------PSFNDY--SSSNFVLDPSYSDQSF 292 Query: 424 KKSNLYTNIDESIAITPRNFVTNPFVATTPSSYLVSTITNLQNRISS 470 N S+ TP ++P T SSY+ S+ + ++ I S Sbjct: 293 -------NFANSVLNTPS---SSPSPTTLNSSYINSSSCSTEDEIES 329 >At3g20860.1 68416.m02637 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 427 Score = 30.3 bits (65), Expect = 3.0 Identities = 23/105 (21%), Positives = 39/105 (37%) Query: 66 TPLVVTSRPLIESIAKSDLNPLPQNNTEAQPSSNGVSFVPFFGKVNEYRPFFGAGPGKPH 125 +PL V ++ + KS L P++ A P+ + P F K Sbjct: 231 SPLPVMYSSSLKRLIKSMLRKNPEHRPTAAELLRHPHLQPYLAQCQNLSPVFKPVVSKSE 290 Query: 126 VNRFENQSPLPPIYRVINEHKVQNKKPYDYDYKVKSPEYNQHDNE 170 N EN++ LPP + N++ + + K K + D E Sbjct: 291 HNTNENRTGLPPKTKSAKTPIKHNQESEETEKKNKDTSSSSKDKE 335 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 30.3 bits (65), Expect = 3.0 Identities = 13/62 (20%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 145 HKVQNKKPYDYDYKVKSPEYNQHDNEIHDENNSDYNHAQNYAFSYTVKDKDTGDDFSHSQ 204 H +N++ + + K E++QH + E + +++H +++ S+ ++ + D H Sbjct: 563 HSHKNEEHHQHSDSHKHEEHHQHSDSHKHEEHHEHDH-HHHSHSHKHEECNHNHDHEHQS 621 Query: 205 HS 206 HS Sbjct: 622 HS 623 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 30.3 bits (65), Expect = 3.0 Identities = 31/124 (25%), Positives = 48/124 (38%), Gaps = 9/124 (7%) Query: 28 HYNYHAFDAERYLKS-LNLPV--PTKQGPVLFPNDAPPAPRTPLVVTSRPLIESIAKSDL 84 H+++H A+ + + LNLP P+ V PP P PL ++ S Sbjct: 449 HHHHHEIPAKDSVDNPLNLPSDPPSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPP 508 Query: 85 NPLP--QNNTEAQPSSNGVSFVP--FFGKVNEYRPFFGAGPGKPHVNRFENQSPLPPIYR 140 P P + T PS P F + P P P + F N+ PL +++ Sbjct: 509 PPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSP--SQPPPPPPLPSFSNRDPLTTLHQ 566 Query: 141 VINE 144 IN+ Sbjct: 567 PINK 570 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.9 bits (64), Expect = 4.0 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 7/46 (15%) Query: 57 PNDAPPAPRTPLVVTSRPLIESIAKSDLNPLPQNNTEAQPSSNGVS 102 P APPAP TP+V TS P P P P SNG+S Sbjct: 710 PPPAPPAPPTPIVHTSSP-------PPPPPPPPPPAPPTPQSNGIS 748 >At5g26980.1 68418.m03219 syntaxin 41 (SYP41) / TLG2a identical to SP|O65359 Syntaxin 41 (AtSYP41) (AtTLG2a) {Arabidopsis thaliana} Length = 322 Score = 29.9 bits (64), Expect = 4.0 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 4/75 (5%) Query: 343 DDYSSELNSNYPSYISKFKSFADDKINDNYQVVTSTS--KPNFDDIRNLLIDEKTYNTRQ 400 DD+ LN + S I K + + ++ + QVV S + D+ L+ID+ T R Sbjct: 208 DDFGDMLNEHQMSKIKKSEEVSVEREKEIQQVVESVNDLAQIMKDLSALVIDQGTIVDRI 267 Query: 401 SYNDIEPNSQSTLKD 415 YN IE N +T++D Sbjct: 268 DYN-IE-NVATTVED 280 >At3g03200.1 68416.m00316 no apical meristem (NAM) family protein similar to NAC2 (GI:6456751) {Arabidopsis thaliana} Length = 479 Score = 29.9 bits (64), Expect = 4.0 Identities = 22/103 (21%), Positives = 45/103 (43%), Gaps = 6/103 (5%) Query: 280 YRKTNYDRGNNFNNYISTTRSYDDDVINSNKIANNDNDYGLNDYAKLKNQNEYVNYDSKE 339 + +N + N+ + + +YD+ +I SN+ N + Y +K Q + D+ + Sbjct: 281 FAASNSNHNNSVGDQVIHVGNYDEQLITSNRHMNQNYIYAFEKTGYIKEQKIRSSLDNTD 340 Query: 340 FYNDDYSSELNSN--YPSYISKFKSFADDKIN---DNYQVVTS 377 + + N N ++S F + +D +N DN V T+ Sbjct: 341 EDPGFHGNNTNDNIDIDDFLS-FDIYNEDNVNQIEDNEDVNTN 382 >At5g60130.1 68418.m07538 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 300 Score = 29.5 bits (63), Expect = 5.3 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 1/87 (1%) Query: 302 DDDVINSNKIANNDNDYGLNDYAKLKNQNEYVNYDSKEFYNDDYSSELNSNYPSYISKFK 361 DDD + N +ND+D ++ A K+ N+ + D DD E + ++ S+ Sbjct: 122 DDDDSDYNCGEDNDSDDYADEAAVEKDDNDADDEDVDNVA-DDVPVEDDDYVEAFDSRDH 180 Query: 362 SFADDKINDNYQVVTSTSKPNFDDIRN 388 + ADD D Q + P+F I N Sbjct: 181 AKADDDDEDERQYLDDRENPSFTLILN 207 >At4g12250.1 68417.m01942 NAD-dependent epimerase/dehydratase family protein similar to nucleotide sugar epimerase from Vibrio vulnificus GI:3093975 [PID:g3093975], WbnF [Escherichia coli] GI:5739472, CAPI protein {Staphylococcus aureus} SP|P39858; contains Pfam profile PF01370 NAD dependent epimerase/dehydratase family Length = 436 Score = 29.5 bits (63), Expect = 5.3 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 50 KQGPVLFP----NDAPPAPRTPLVVTSRPLIESIAKSDLNPLPQN 90 K+GP +F + P P T LV L++ AK + PLP+N Sbjct: 343 KKGPAMFRIYNLGNTSPVPVTKLVTILEKLLKMKAKKKIMPLPRN 387 >At3g08790.1 68416.m01021 VHS domain-containing protein / GAT domain-containing protein weak similarity to HGF-regulated tyrosine kinase substrate [Mus musculus] GI:1089781; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 607 Score = 29.5 bits (63), Expect = 5.3 Identities = 20/82 (24%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Query: 61 PPAPRTPLVVTSRPLIESIAKSDLN---PLPQNNTEAQPSSNGVSFVPFFGKVNEYRPFF 117 PP P +P+ ++ SD N P +N A ++ FG ++ + ++ Sbjct: 332 PPQPSSPVAKPDNSIVLIDMLSDNNCESSTPTSNPHANHQKVQQNYSNGFGPGHQEQSYY 391 Query: 118 GAGPGKPHVNRFENQSPLPPIY 139 G G P N Q P P Y Sbjct: 392 GQGSSAPVWNLQITQQPSSPAY 413 >At5g27960.1 68418.m03367 MADS-box protein (AGL90) Length = 320 Score = 29.1 bits (62), Expect = 7.0 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 7/97 (7%) Query: 296 STTRSYDD-DVINSNKIANN-----DNDYGLN-DYAKLKNQNEYVNYDSKEFYNDDYSSE 348 STTR D + N + +A + D D N + + + N N +EFYN + + Sbjct: 189 STTRVVDTPNATNPHVLAGDMTPFLDADANANMNQVQYQAPNNLFNQIQREFYNINLNLN 248 Query: 349 LNSNYPSYISKFKSFADDKINDNYQVVTSTSKPNFDD 385 LN N Y+++ +SF + + + V F D Sbjct: 249 LNLNSNQYLNQQQSFMNPMVEQHMNHVGGRESIPFVD 285 >At3g58710.1 68416.m06543 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 272 Score = 29.1 bits (62), Expect = 7.0 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 387 RNLLIDEKTYNTRQSYNDIEPNSQSTLKDNSYNPVNFKKSNLYTNIDESIAITP 440 R I E ++YND+ P S S+ +D+ + KKS N+++ + P Sbjct: 3 RRAAIQESDDEEDETYNDVVPESPSSCEDSKISKPTPKKSR--RNVEKRVVSVP 54 >At1g70370.1 68414.m08095 BURP domain-containing protein / polygalacturonase, putative similar to polygalacturonase isoenzyme 1 beta subunit [Lycopersicon esculentum] GI:170480; contains Pfam profile PF03181: BURP domain Length = 626 Score = 29.1 bits (62), Expect = 7.0 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Query: 275 NVITDYRKTNYDRGNNFNNYISTTRSYDDDVINSNKIANNDNDYGLNDYAKLKNQNE--Y 332 + T Y NNFNNY ++ + D N AN +D + YAK N + + Sbjct: 278 DTFTSYGSDGNVPQNNFNNYGASGNAAVDTFANYRDKANVGDD-SFSSYAKDSNSEKVNF 336 Query: 333 VNY 335 VNY Sbjct: 337 VNY 339 >At5g48310.1 68418.m05968 expressed protein Length = 1156 Score = 28.7 bits (61), Expect = 9.3 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 9/73 (12%) Query: 287 RGNNFNNYISTTRSYDDDVINSNKIANNDNDYG------LNDYAKLKNQNEYV---NYDS 337 R +N ++ I T + +DD N N + +D G +DY + E V YD Sbjct: 29 RNSNLSSPILVTPTLNDDESNDNMSIESVSDTGEGNELLFSDYDVEDEEEEEVIGRRYDE 88 Query: 338 KEFYNDDYSSELN 350 +E + D +S+LN Sbjct: 89 EEVFGDKSNSKLN 101 >At5g26650.1 68418.m03175 MADS-box protein (AGL36) contains interpro domain: IPR002100 transcriptor factor, MADS box; contains Pfam profile PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain) Length = 327 Score = 28.7 bits (61), Expect = 9.3 Identities = 20/92 (21%), Positives = 38/92 (41%), Gaps = 1/92 (1%) Query: 295 ISTTRSYDDDVINSNKIANNDNDYGLN-DYAKLKNQNEYVNYDSKEFYNDDYSSELNSNY 353 + T + + V+ + D D N + + + N N +EFYN + + LN N Sbjct: 196 VDTLNATNPHVLTGDMTPFLDADATANMNQVQYQAPNNLFNQIQREFYNINLNLNLNLNS 255 Query: 354 PSYISKFKSFADDKINDNYQVVTSTSKPNFDD 385 Y+++ +SF + + + V F D Sbjct: 256 NQYLNQQQSFMNPMVEQHMNHVGGRESIPFVD 287 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.7 bits (61), Expect = 9.3 Identities = 24/102 (23%), Positives = 37/102 (36%), Gaps = 5/102 (4%) Query: 46 PVPTKQGPVLFPNDAPPAPRTP--LVVTSRPLIESIAKSDLNPLPQNNTEAQPSSNGVSF 103 P P P P PP P P + + S P++ + +PL + + P +G+ Sbjct: 62 PPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMPSGMES 121 Query: 104 VPFFGKVNEYRPFFGAGPGKPHVNRFENQSPLPPIYRVINEH 145 P G + P A P N N L + V+ H Sbjct: 122 SPSPGPM---PPAMAASPDSGAFNVRNNVVTLSCVVGVVAAH 160 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 28.7 bits (61), Expect = 9.3 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Query: 287 RGNNFNNYISTTRSYDDDVINSNKIANNDNDYGLNDYAKLKNQNEYVNYDSKEFYNDDYS 346 +GNN NN + + +D+ N+N NNDN+ G N K N N N + ND+ Sbjct: 68 QGNN-NNDGNNGNNNNDNNNNNNGNNNNDNNNGNN---KDNNNNGNNNNGNNNNGNDNNG 123 Query: 347 SELNSN 352 + N N Sbjct: 124 NNNNGN 129 >At2g27170.1 68415.m06029 structural maintenance of chromosomes (SMC) family protein similar to basement membrane-associated chondroitin proteoglycan Bamacan [Rattus norvegicus] GI:1785540; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain. No suitalble start codon was identified. Length = 1207 Score = 28.7 bits (61), Expect = 9.3 Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 140 RVINEHKVQNKKPYDYDYKVKSPEYNQHDNEIHD 173 R ++E K + +K D + KS EY +D E+HD Sbjct: 201 RELDEEKEELRKYQQLDKQRKSLEYTIYDKELHD 234 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.312 0.131 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,923,113 Number of Sequences: 28952 Number of extensions: 631089 Number of successful extensions: 1552 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 22 Number of HSP's that attempted gapping in prelim test: 1529 Number of HSP's gapped (non-prelim): 49 length of query: 492 length of database: 12,070,560 effective HSP length: 84 effective length of query: 408 effective length of database: 9,638,592 effective search space: 3932545536 effective search space used: 3932545536 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -