BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000165-TA|BGIBMGA000165-PA|undefined (102 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 0.98 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 1.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 4.0 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 20 5.2 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 20 5.2 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.6 bits (46), Expect = 0.98 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Query: 19 QHQISQTPSTKQPQSILKDPSRHKYGHPYGSPVSSST--PHNSN 60 QH + P +Q + + +H G Y SP+S+S+ P++ N Sbjct: 106 QHVVYGNPQQQQLAAETQQQQQHNNG--YASPMSTSSYDPYSPN 147 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 1.7 Identities = 11/48 (22%), Positives = 23/48 (47%) Query: 54 STPHNSNQILTVQNLTSDTPQYGTIKKENKKQNVTIDESFNKRSETHV 101 +T ++N+I+T Q L + +N + I ++ +ETH+ Sbjct: 412 TTEKDNNEIVTAQFLNQLKKSSVLVHTKNGRLKYQISDNDISTNETHI 459 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 4.0 Identities = 9/34 (26%), Positives = 15/34 (44%) Query: 39 SRHKYGHPYGSPVSSSTPHNSNQILTVQNLTSDT 72 S H + H G+P ++ T + T T+ T Sbjct: 643 STHSHPHEPGAPATTITTITTTTTTTTTTTTTTT 676 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 5.2 Identities = 6/20 (30%), Positives = 11/20 (55%) Query: 11 VLHPGNCAQHQISQTPSTKQ 30 +LHP C Q +++ K+ Sbjct: 15 LLHPSRCTQGKVNYREKEKE 34 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 5.2 Identities = 6/20 (30%), Positives = 11/20 (55%) Query: 11 VLHPGNCAQHQISQTPSTKQ 30 +LHP C Q +++ K+ Sbjct: 15 LLHPSRCTQGKVNYREKEKE 34 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.307 0.123 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,601 Number of Sequences: 429 Number of extensions: 1525 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 102 length of database: 140,377 effective HSP length: 49 effective length of query: 53 effective length of database: 119,356 effective search space: 6325868 effective search space used: 6325868 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (19.9 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -