BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000163-TA|BGIBMGA000163-PA|IPR007110|Immunoglobulin-like (143 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 39 2e-05 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 5.7 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 39.1 bits (87), Expect = 2e-05 Identities = 30/112 (26%), Positives = 48/112 (42%), Gaps = 5/112 (4%) Query: 2 SENVLSFTADASDNKARYSCEAKNIMISNTLKAEIDLTVLFAPAHVTISGPSE-ARVGDP 60 +E VL + ++K Y C +N S AE+ L F P + + E + G+ Sbjct: 371 NEAVLRIESVRKEDKGMYQCFIRNDQESAEATAELKLGGRFEPPQIRHAFNEETVQPGNS 430 Query: 61 VPLTCSTAPSNPAAEIKWLVIGKHHKEASNRTV---ISPEGGWITSSNITVI 109 V L C A NP EI W + G+ + + ++ G ++ NIT I Sbjct: 431 VFLKC-IASGNPTPEITWELYGRRLSNSERNQIGQYVTVNGDVVSHLNITAI 481 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 20.6 bits (41), Expect = 5.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Query: 43 APAHVTISGPSEARVGDPVPLTCSTA 68 +P+ IS PS + G P LT + A Sbjct: 66 SPSSPRISSPSSTKSGSPGFLTYTKA 91 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.127 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,463 Number of Sequences: 317 Number of extensions: 1185 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 143 length of database: 114,650 effective HSP length: 51 effective length of query: 92 effective length of database: 98,483 effective search space: 9060436 effective search space used: 9060436 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.6 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -