BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000161-TA|BGIBMGA000161-PA|undefined (108 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 1.8 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 22 4.2 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 21 7.4 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 21 9.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 21 9.8 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 75 LGGRSSLCRKPQRGDQNE 92 LGGR + CR +GD+ E Sbjct: 576 LGGRCTDCRPGMKGDKGE 593 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 22.2 bits (45), Expect = 4.2 Identities = 12/35 (34%), Positives = 21/35 (60%) Query: 36 RKIIDRCLNLAYDIFKIKRIYTSSEQQHSDLRSIE 70 R +ID+ LA ++K++ TS E+Q +R+ E Sbjct: 319 RNVIDQEEQLAAVDDELKKLRTSIEEQEHRIRNRE 353 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 21.4 bits (43), Expect = 7.4 Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 52 IKRIYTSSEQQHSDLRSIEQYHPLGGRSSLCRKPQRGDQNEMRESFPMTPKGTYAL 107 ++R + +++ Q R E + + P G +FP+TP+ Y L Sbjct: 1072 VQRAHDNAKLQTIGARE-ESFSSYRSETEPDNSPMGGSPRPETPAFPVTPRTPYGL 1126 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Query: 56 YTSSEQQHSDLRSIEQYHPL 75 Y+SSE L S E Y P+ Sbjct: 477 YSSSESDSDSLSSEEFYQPI 496 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Query: 56 YTSSEQQHSDLRSIEQYHPL 75 Y+SSE L S E Y P+ Sbjct: 477 YSSSESDSDSLSSEEFYQPI 496 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.137 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,753 Number of Sequences: 2123 Number of extensions: 3858 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 5 length of query: 108 length of database: 516,269 effective HSP length: 56 effective length of query: 52 effective length of database: 397,381 effective search space: 20663812 effective search space used: 20663812 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -