BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000161-TA|BGIBMGA000161-PA|undefined (108 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39744-1|AAK18882.1| 471|Caenorhabditis elegans Hypothetical pr... 27 2.8 >U39744-1|AAK18882.1| 471|Caenorhabditis elegans Hypothetical protein C03F11.1 protein. Length = 471 Score = 27.1 bits (57), Expect = 2.8 Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 6 YHTVMEHHGKDFIPETEVVGKGVWRVAIIQRKIIDRCL 43 YH ++ +H D + E G WRV + ++I C+ Sbjct: 126 YHIIL-YHLNDIVLELVDCGADDWRVVVTTERVIQFCI 162 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.321 0.137 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,852,499 Number of Sequences: 27539 Number of extensions: 104104 Number of successful extensions: 207 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 207 Number of HSP's gapped (non-prelim): 1 length of query: 108 length of database: 12,573,161 effective HSP length: 71 effective length of query: 37 effective length of database: 10,617,892 effective search space: 392862004 effective search space used: 392862004 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -