SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000161-TA|BGIBMGA000161-PA|undefined
         (108 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U39744-1|AAK18882.1|  471|Caenorhabditis elegans Hypothetical pr...    27   2.8  

>U39744-1|AAK18882.1|  471|Caenorhabditis elegans Hypothetical
           protein C03F11.1 protein.
          Length = 471

 Score = 27.1 bits (57), Expect = 2.8
 Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 6   YHTVMEHHGKDFIPETEVVGKGVWRVAIIQRKIIDRCL 43
           YH ++ +H  D + E    G   WRV +   ++I  C+
Sbjct: 126 YHIIL-YHLNDIVLELVDCGADDWRVVVTTERVIQFCI 162


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.321    0.137    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,852,499
Number of Sequences: 27539
Number of extensions: 104104
Number of successful extensions: 207
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 207
Number of HSP's gapped (non-prelim): 1
length of query: 108
length of database: 12,573,161
effective HSP length: 71
effective length of query: 37
effective length of database: 10,617,892
effective search space: 392862004
effective search space used: 392862004
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -