BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000161-TA|BGIBMGA000161-PA|undefined
(108 letters)
Database: celegans
27,539 sequences; 12,573,161 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U39744-1|AAK18882.1| 471|Caenorhabditis elegans Hypothetical pr... 27 2.8
>U39744-1|AAK18882.1| 471|Caenorhabditis elegans Hypothetical
protein C03F11.1 protein.
Length = 471
Score = 27.1 bits (57), Expect = 2.8
Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
Query: 6 YHTVMEHHGKDFIPETEVVGKGVWRVAIIQRKIIDRCL 43
YH ++ +H D + E G WRV + ++I C+
Sbjct: 126 YHIIL-YHLNDIVLELVDCGADDWRVVVTTERVIQFCI 162
Database: celegans
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 12,573,161
Number of sequences in database: 27,539
Lambda K H
0.321 0.137 0.416
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,852,499
Number of Sequences: 27539
Number of extensions: 104104
Number of successful extensions: 207
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 207
Number of HSP's gapped (non-prelim): 1
length of query: 108
length of database: 12,573,161
effective HSP length: 71
effective length of query: 37
effective length of database: 10,617,892
effective search space: 392862004
effective search space used: 392862004
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 53 (25.4 bits)
- SilkBase 1999-2023 -