Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000159-TA|BGIBMGA000159-PA|undefined
         (339 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    24   1.6  

>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 3/43 (6%)

Query: 36  HSTYELVSKIL--YLPLLDPKITYMTEARNEWLLTCPNTDLPT 76
           H   +L+ KI   YLP +   +    + R  W++  PN  LPT
Sbjct: 328 HRMPQLIRKIFLKYLPTI-LMMRRPKKTRLRWMMEIPNVTLPT 369


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.323    0.138    0.442 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,419
Number of Sequences: 429
Number of extensions: 3781
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 339
length of database: 140,377
effective HSP length: 58
effective length of query: 281
effective length of database: 115,495
effective search space: 32454095
effective search space used: 32454095
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 44 (21.8 bits)