BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000159-TA|BGIBMGA000159-PA|undefined (339 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 25 2.3 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 5.3 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 25.4 bits (53), Expect = 2.3 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query: 169 GLSCVKSAGRISRYASINDIIRRALVSAGVPAILEPNGLVRSDGKRSDGMSI 220 GL C +AG+ +R +S+ D+I+ A + LE D +R G I Sbjct: 130 GLGC--NAGQTNRCSSLKDLIKHGETQAVIEIHLENTAFNAYDPERYGGRII 179 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 24.2 bits (50), Expect = 5.3 Identities = 10/37 (27%), Positives = 17/37 (45%) Query: 168 HGLSCVKSAGRISRYASINDIIRRALVSAGVPAILEP 204 HG S G + + ++ND+I + A +L P Sbjct: 153 HGSSVAGGLGSVGSFVAVNDVIGMNITPALSQVLLAP 189 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.138 0.442 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 357,300 Number of Sequences: 2123 Number of extensions: 14127 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 2 length of query: 339 length of database: 516,269 effective HSP length: 64 effective length of query: 275 effective length of database: 380,397 effective search space: 104609175 effective search space used: 104609175 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -