BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000159-TA|BGIBMGA000159-PA|undefined
(339 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 24 1.6
>DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine
receptor beta1subunit protein.
Length = 520
Score = 24.2 bits (50), Expect = 1.6
Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 3/43 (6%)
Query: 36 HSTYELVSKIL--YLPLLDPKITYMTEARNEWLLTCPNTDLPT 76
H +L+ KI YLP + + + R W++ PN LPT
Sbjct: 328 HRMPQLIRKIFLKYLPTI-LMMRRPKKTRLRWMMEIPNVTLPT 369
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.323 0.138 0.442
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,419
Number of Sequences: 429
Number of extensions: 3781
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 339
length of database: 140,377
effective HSP length: 58
effective length of query: 281
effective length of database: 115,495
effective search space: 32454095
effective search space used: 32454095
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -