BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000157-TA|BGIBMGA000157-PA|IPR004827|Basic-leucine zipper (bZIP) transcription factor, IPR008917|Eukaryotic transcription factor, DNA-binding, IPR004826|Maf transcription factor (122 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 8e-20 SB_16005| Best HMM Match : bZIP_Maf (HMM E-Value=5.6e-32) 86 7e-18 SB_43304| Best HMM Match : bZIP_Maf (HMM E-Value=1e-05) 54 2e-08 SB_29484| Best HMM Match : bZIP_Maf (HMM E-Value=0.011) 44 5e-05 SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) 38 0.003 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.012 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 36 0.012 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 35 0.021 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.049 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.065 SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.065 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 33 0.086 SB_20196| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.11 SB_4276| Best HMM Match : DUF288 (HMM E-Value=1e-04) 32 0.11 SB_770| Best HMM Match : DUF837 (HMM E-Value=1.4) 32 0.11 SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) 32 0.15 SB_42254| Best HMM Match : PH (HMM E-Value=5.5e-19) 31 0.26 SB_45073| Best HMM Match : ERM (HMM E-Value=0) 31 0.26 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.46 SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.46 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 30 0.46 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 30 0.46 SB_43986| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 30 0.61 SB_16649| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_4107| Best HMM Match : M (HMM E-Value=8e-22) 30 0.61 SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) 30 0.61 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) 30 0.61 SB_11160| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.80 SB_17268| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.7) 29 0.80 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 29 0.80 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 29 0.80 SB_41032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.80 SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.80 SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 29 1.1 SB_9049| Best HMM Match : SMC_C (HMM E-Value=0.0098) 29 1.1 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_56150| Best HMM Match : Psf2 (HMM E-Value=1.7) 29 1.1 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 29 1.1 SB_31403| Best HMM Match : PAN (HMM E-Value=2.7e-18) 29 1.1 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) 29 1.1 SB_286| Best HMM Match : M (HMM E-Value=0.39) 29 1.1 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 29 1.4 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_18803| Best HMM Match : KE2 (HMM E-Value=1.5) 29 1.4 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_48387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_18608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_9039| Best HMM Match : M (HMM E-Value=0.00046) 29 1.4 SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) 28 1.9 SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) 28 1.9 SB_54| Best HMM Match : Actin (HMM E-Value=0) 28 1.9 SB_57947| Best HMM Match : DSHCT (HMM E-Value=1.2e-08) 28 1.9 SB_32857| Best HMM Match : TolA (HMM E-Value=1.1) 28 1.9 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 28 2.4 SB_46257| Best HMM Match : Mod_r (HMM E-Value=1.2) 28 2.4 SB_34153| Best HMM Match : DUF972 (HMM E-Value=0.17) 28 2.4 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_43065| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_39000| Best HMM Match : TolA (HMM E-Value=0.55) 28 2.4 SB_17789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) 28 2.4 SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) 27 3.2 SB_57710| Best HMM Match : bZIP_1 (HMM E-Value=0.32) 27 3.2 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 27 3.2 SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) 27 3.2 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 27 3.2 SB_18662| Best HMM Match : Toxin_27 (HMM E-Value=2) 27 3.2 SB_18060| Best HMM Match : Pepsin-I3 (HMM E-Value=0.67) 27 3.2 SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) 27 3.2 SB_396| Best HMM Match : DUF217 (HMM E-Value=4.3) 27 3.2 SB_56664| Best HMM Match : bZIP_1 (HMM E-Value=0.00033) 27 3.2 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 27 3.2 SB_50496| Best HMM Match : FHA (HMM E-Value=7.8e-07) 27 3.2 SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1) 27 4.3 SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) 27 4.3 SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) 27 4.3 SB_32407| Best HMM Match : WSC (HMM E-Value=0.0008) 27 4.3 SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_28785| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_13076| Best HMM Match : NUC202 (HMM E-Value=3) 27 4.3 SB_45619| Best HMM Match : M (HMM E-Value=0.01) 27 4.3 SB_30869| Best HMM Match : DUF164 (HMM E-Value=0.18) 27 4.3 SB_59267| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 27 5.7 SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) 27 5.7 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_24029| Best HMM Match : Kinesin (HMM E-Value=2.10195e-44) 27 5.7 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) 27 5.7 SB_10762| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 27 5.7 SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_44890| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_36565| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 27 5.7 SB_21467| Best HMM Match : Peptidase_A17 (HMM E-Value=1.1e-22) 27 5.7 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 27 5.7 SB_6581| Best HMM Match : HEAT (HMM E-Value=3e-05) 27 5.7 SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) 27 5.7 SB_59762| Best HMM Match : Vicilin_N (HMM E-Value=4) 26 7.5 SB_50642| Best HMM Match : Spectrin (HMM E-Value=1) 26 7.5 SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_36254| Best HMM Match : Filament (HMM E-Value=0.21) 26 7.5 SB_32194| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_29556| Best HMM Match : Ion_trans (HMM E-Value=0) 26 7.5 SB_27924| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_10083| Best HMM Match : Ion_trans (HMM E-Value=0) 26 7.5 SB_7100| Best HMM Match : zf-DBF (HMM E-Value=2.6e-09) 26 7.5 SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_47589| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_46937| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_46461| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 26 7.5 SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 26 9.9 SB_54706| Best HMM Match : Linker_histone (HMM E-Value=0.014) 26 9.9 SB_54691| Best HMM Match : SWIRM (HMM E-Value=0.0033) 26 9.9 SB_41162| Best HMM Match : FbpA (HMM E-Value=0.043) 26 9.9 SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) 26 9.9 SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 26 9.9 SB_15422| Best HMM Match : TACC (HMM E-Value=6.4e-20) 26 9.9 SB_58222| Best HMM Match : HS1_rep (HMM E-Value=0) 26 9.9 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 26 9.9 SB_50076| Best HMM Match : Filament (HMM E-Value=0.15) 26 9.9 SB_49480| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_48727| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_46938| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_35619| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_14999| Best HMM Match : E-MAP-115 (HMM E-Value=0.71) 26 9.9 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_12735| Best HMM Match : PT (HMM E-Value=0.36) 26 9.9 SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) 26 9.9 SB_4328| Best HMM Match : Vicilin_N (HMM E-Value=0.39) 26 9.9 >SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 92.7 bits (220), Expect = 8e-20 Identities = 44/102 (43%), Positives = 69/102 (67%), Gaps = 2/102 (1%) Query: 10 EISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELE 69 +ISD+ L +I V+DLN L RGL D + ++KQRRRTLKNRGYA + R KR+ Q+++LE Sbjct: 14 DISDELLATIPVKDLNNLL--RGLPEDDVFKLKQRRRTLKNRGYAQNSRTKRVRQREDLE 71 Query: 70 NEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMKS 111 E+ Q ++ ++ EN +R E + + KYD+L++ T ++ Sbjct: 72 YERQQLKDELFMVSKENEDLRRERDEAKRKYDSLQKLLTSRT 113 >SB_16005| Best HMM Match : bZIP_Maf (HMM E-Value=5.6e-32) Length = 160 Score = 86.2 bits (204), Expect = 7e-18 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 7/95 (7%) Query: 11 ISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELEN 70 ++++EL + V++LNR LK +GL+ ++ R+K RRRTLKNRGYA +CRIKRI QK LE Sbjct: 57 VTEEELAELGVKELNRLLKSKGLSTEEQSRIKYRRRTLKNRGYAHNCRIKRISQKKSLE- 115 Query: 71 EKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 W EL+QD N +R+E+EA + + D KR Sbjct: 116 --ETNW---ELVQDLEN-LRKELEASKRERDMYKR 144 >SB_43304| Best HMM Match : bZIP_Maf (HMM E-Value=1e-05) Length = 96 Score = 54.4 bits (125), Expect = 2e-08 Identities = 26/82 (31%), Positives = 48/82 (58%) Query: 30 MRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRI 89 MRGL +IVR+++RRR+LKNR YA+ C+ KR+ ++ E + + ++ E ++ Sbjct: 1 MRGLENSEIVRLRKRRRSLKNRIYASVCKKKRVAEQKTYEVQNRILVKERNTLKMELEKV 60 Query: 90 REEIEALRSKYDALKRFATMKS 111 + E + ++ Y L++ M S Sbjct: 61 KTERDKIKEAYQTLEKVFIMLS 82 >SB_29484| Best HMM Match : bZIP_Maf (HMM E-Value=0.011) Length = 136 Score = 43.6 bits (98), Expect = 5e-05 Identities = 21/43 (48%), Positives = 32/43 (74%), Gaps = 2/43 (4%) Query: 10 EISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRG 52 + +D EL+ +SVR+LN K+RGL +I +++RRR+LKNRG Sbjct: 89 QFTDKELMELSVRELNT--KLRGLPSTEIDTIRKRRRSLKNRG 129 >SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) Length = 496 Score = 37.5 bits (83), Expect = 0.003 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 7/75 (9%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 +K RR +N+ A+ CR KR ++ +EL+ E ++ ++++N + +I LR +Y Sbjct: 288 LKIIRRRQRNKQAASRCREKRRQRLEELQREATE-------LEEQNAEVERDIATLRVEY 340 Query: 101 DALKRFATMKSIPLP 115 + L+ T + LP Sbjct: 341 NELEALLTEHACVLP 355 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 35.5 bits (78), Expect = 0.012 Identities = 19/64 (29%), Positives = 39/64 (60%), Gaps = 7/64 (10%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 +K R+ L+NR A+ CR +++E++ ELE++ +++++D+N ++ E + LR Sbjct: 133 VKNERKKLRNRLAASKCRKRKLEKEAELEDK-------VKVLKDKNTKLVSEAQELRRLV 185 Query: 101 DALK 104 LK Sbjct: 186 CELK 189 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 35.5 bits (78), Expect = 0.012 Identities = 23/93 (24%), Positives = 53/93 (56%), Gaps = 9/93 (9%) Query: 13 DDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKR-IEQKDELENE 71 D+ L ++ + ++ + K+ L +D+ ++ + ++ G A R++R +E+K++ N+ Sbjct: 2398 DNRLTTLEIEKIDIEKKLESL-KDEY--SGEKTKLVEAEGNLA--RVQRDLEEKEKKLND 2452 Query: 72 KSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 Q +L ++E NR++EE+ A +YD L+ Sbjct: 2453 IKQA---SDLSENEGNRLKEELNAFTERYDELR 2482 Score = 29.9 bits (64), Expect = 0.61 Identities = 22/86 (25%), Positives = 46/86 (53%), Gaps = 9/86 (10%) Query: 27 QLKMRGLTRDQIVRMKQ-RRRTLKNRGYA------ASCRIKRIEQKD-ELENEKSQEWHD 78 Q K+R +T D+++R+K T K +G A R+ +E + + E E ++ H+ Sbjct: 1725 QEKLR-VTTDELIRLKPVSEATQKKKGQVETELQNARKRLATLETTERKSEEELAKANHE 1783 Query: 79 MELMQDENNRIREEIEALRSKYDALK 104 +++ +DE +R+ E+ A + + L+ Sbjct: 1784 IQVSKDEISRLETELNAAKKRASCLQ 1809 Score = 28.3 bits (60), Expect = 1.9 Identities = 16/67 (23%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Query: 42 KQRRRTLKNRGYAASCRIKRIE-QKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 ++ R+++NR A +I+RI+ ++ +L + EN RI + + + KY Sbjct: 654 RRELRSMENRASRAEQQIQRIDKERMDLIRKLDVTQGTRRRADGENRRIENQFQEFQEKY 713 Query: 101 DALKRFA 107 ++L + A Sbjct: 714 ESLNQEA 720 Score = 27.1 bits (57), Expect = 4.3 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Query: 35 RDQIVRMKQRRRTLKN-RGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEI 93 R +I R+++ + LK+ + A R + IE+ E+E+ +S+ ++D +R+ E Sbjct: 3551 RAEISRLEKEVKRLKDDQELARKQRQEVIEKGREIEDLQSKFKRKEREVEDLKHRLLRET 3610 Query: 94 EALRSKYDALKR 105 E + +D LK+ Sbjct: 3611 EQEKKLHDGLKK 3622 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/44 (27%), Positives = 23/44 (52%) Query: 61 RIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 R + D L +E D+ + EN +R + +L+++ D+LK Sbjct: 3380 RDNRNDALGDELETLKRDLSSSEKENTDLRSTVRSLKAEVDSLK 3423 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/42 (28%), Positives = 24/42 (57%) Query: 64 QKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 +K+ELE E + HD EL+ ++ ++E + L + +K+ Sbjct: 733 EKEELEEELKRFKHDFELIGNDLKMCKKEKDQLHVELTNIKQ 774 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 34.7 bits (76), Expect = 0.021 Identities = 18/68 (26%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Query: 35 RDQIVRMKQRRRTLKNRGYAASCRIKR-IEQKDELENEKSQEWHDMELMQDENNRIREEI 93 R+ +++ ++LK + +K+ IE+KDE S++ HD+ + N+ RE+I Sbjct: 826 RELATEHEKQLQSLKTDFSVTTAEMKQTIERKDEELKSNSEQLHDLSGKLEALNKQREDI 885 Query: 94 EALRSKYD 101 ++L++ +D Sbjct: 886 DSLQANFD 893 Score = 28.7 bits (61), Expect = 1.4 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Query: 39 VRMKQRRRTLKNRGYAASCRIKRIE-QKDELENEKSQEWHD-MELMQDENNRIREEIEAL 96 +R+K ++ + I++I +K E+ + QE+ + ++ D + +REE+E L Sbjct: 287 IRLKNNIKSTREEKEKMKAEIEKISSEKHEICTKLRQEFEEALKDKDDVLSSLREEMECL 346 Query: 97 RSKYDAL 103 R++ D+L Sbjct: 347 RAEKDSL 353 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 60 KRIEQKDELENEKSQEWHDMELMQDENNRIREEIE 94 +R E+ L EK Q + D+E E R+E+E Sbjct: 2026 ERFEETRRLYEEKCQGYTDLETHLKEEREARQELE 2060 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 33.5 bits (73), Expect = 0.049 Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 10/106 (9%) Query: 13 DDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNR-----GYAASCRIKRIEQKDE 67 D E S+R+ +Q + LT + +K+ RR K + G +++R + E Sbjct: 2507 DRENFKTSLRESQKQNE--DLT-SMVNELKEERRNEKQKKEEAEGLVEKLKVQRNQMIKE 2563 Query: 68 LENEKSQEW--HDMELMQDENNRIREEIEALRSKYDALKRFATMKS 111 +E KS++ + MQDE ++R EIE L+ + A KS Sbjct: 2564 IEELKSEKGLLEQKQQMQDEAQKLRNEIEVLKKLHAIALEDANQKS 2609 Score = 28.3 bits (60), Expect = 1.9 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 6/86 (6%) Query: 15 ELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQK-DELENEKS 73 E+ V L+R MR D+IV +++ R LKN + ++ EQK ++LE S Sbjct: 2298 EMQKTEVMPLDRSEVMRA-NLDRIVALEEERNQLKNELRLSEDKLHEAEQKFEKLEVALS 2356 Query: 74 QEWHDMELMQDENNRIREEIEALRSK 99 Q +E + + + E ++AL+ + Sbjct: 2357 Q----LESISEVFHSGTENVDALKKE 2378 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 33.1 bits (72), Expect = 0.065 Identities = 26/92 (28%), Positives = 52/92 (56%), Gaps = 11/92 (11%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDE-LENEKSQEWHDMELMQDENNRIREEIEAL--- 96 ++Q+ +T+KN+ +IK + +K LE + + +++ ++D+N R+ +E+E L Sbjct: 441 LEQQVKTMKNKSDDDDKKIKDLNEKVRVLEKQLKENDAEIQGLKDDNERLEDELEDLSTT 500 Query: 97 ----RSKYD-ALKRFATMK--SIPLPAELDIL 121 R++Y+ LK A +K + L AE+D L Sbjct: 501 IKRGRAEYERILKENAELKDENEALKAEIDAL 532 Score = 28.7 bits (61), Expect = 1.4 Identities = 13/45 (28%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Query: 60 KRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 ++IE DEL N+ + D+E +Q + ++++ ++L+ KY+ L+ Sbjct: 222 EKIEIFDEL-NKLEERLQDLEDLQAQRFELQKKYDSLKEKYETLR 265 Score = 26.2 bits (55), Expect = 7.5 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Query: 60 KRIEQK-DELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 +R+E + ++L + + E + EN +++E EAL+++ DALK Sbjct: 488 ERLEDELEDLSTTIKRGRAEYERILKENAELKDENEALKAEIDALK 533 >SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 808 Score = 33.1 bits (72), Expect = 0.065 Identities = 17/78 (21%), Positives = 42/78 (53%), Gaps = 1/78 (1%) Query: 22 RDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMEL 81 ++LN+ L+ + M+++ + L+ IK++EQ EL++++S E EL Sbjct: 509 KELNKVLERNMELESSVSAMERKNKALEKSVNGLEKEIKKMEQNYELKSKESDEKFHREL 568 Query: 82 MQDENNRIREEIEALRSK 99 Q+ +R++++ ++ + Sbjct: 569 -QNTKDRLQKDFQSFHQR 585 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 32.7 bits (71), Expect = 0.086 Identities = 24/102 (23%), Positives = 47/102 (46%), Gaps = 2/102 (1%) Query: 20 SVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDM 79 +V++L RQ+ + + + R + TL ++ ++ +Q+ E ENE M Sbjct: 1119 TVQELERQVGLLQERNNALQRTVKEHETLMDK--LKQKIVRSTDQQKEKENETKTLAERM 1176 Query: 80 ELMQDENNRIREEIEALRSKYDALKRFATMKSIPLPAELDIL 121 + EN +R+E+ A + D L+R + K A++ L Sbjct: 1177 NEVFQENEMLRKELIAAADRIDNLQRRSDEKKTKTQAKVQAL 1218 >SB_20196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 32.3 bits (70), Expect = 0.11 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 7/59 (11%) Query: 42 KQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 K+ R +KNR A CR K+ E LEN + +++++N + EE++AL+ Y Sbjct: 241 KREMRLMKNREAAKECRRKKKEYVKCLENR-------VAVLENQNKTLIEELKALKDLY 292 >SB_4276| Best HMM Match : DUF288 (HMM E-Value=1e-04) Length = 687 Score = 32.3 bits (70), Expect = 0.11 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 14/94 (14%) Query: 3 LSPTP--CAEISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIK 60 LSPTP C EI D++V + N Q ++VR + RTL G A + +K Sbjct: 502 LSPTPKECKEIIQDKVVL----EPNEQPSSYLSAGKKLVR-EVLERTLVKLGDAEADLLK 556 Query: 61 RIEQKDELENEKSQEWHDMELMQDENNRIREEIE 94 Q ELE + L+Q+EN+RIR E++ Sbjct: 557 LQMQNKELETS-------LNLVQEENDRIRPELQ 583 >SB_770| Best HMM Match : DUF837 (HMM E-Value=1.4) Length = 269 Score = 32.3 bits (70), Expect = 0.11 Identities = 26/106 (24%), Positives = 51/106 (48%), Gaps = 7/106 (6%) Query: 8 CAEISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDE 67 C I DE +++ RD+ QL+ + + R + + + R+K E + E Sbjct: 6 CLHIFTDE--TLNARDIQLQLERVKAKNEILERDNGKLEERCDELFEEIVRMK--ESQRE 61 Query: 68 LENEKSQEWHDMELMQDENNRIR---EEIEALRSKYDALKRFATMK 110 +E E+ + + D+E ++DEN +R ++I+ L + KR +K Sbjct: 62 VEEEQEKLFKDIETLEDENFYLRKYVDKIQELEEMTNTSKRLDQLK 107 >SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) Length = 1183 Score = 31.9 bits (69), Expect = 0.15 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 11/90 (12%) Query: 26 RQLKMRGLTRDQIVR-MKQRRRTLKNRGYAASCRIKRIEQKD--ELENEKSQEWHDMELM 82 R+L+ + T D VR +KQ+++ L+ +K E+K +LEN ++ M Sbjct: 177 RRLEQQKQTLDYEVRELKQKKQNLE-------LELKNAEKKGSRQLENMLKDHEEEVRRM 229 Query: 83 QDENNRIREEIEALRSKYDALK-RFATMKS 111 ++E + EEI+ALR + + K R + +KS Sbjct: 230 KEERKDLCEEIKALREEVNEFKARVSHLKS 259 >SB_42254| Best HMM Match : PH (HMM E-Value=5.5e-19) Length = 996 Score = 31.1 bits (67), Expect = 0.26 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 2/80 (2%) Query: 42 KQRRRTLKNRGYAASCRIKRIEQKDELENE-KSQEWHDMELMQD-ENNRIREEIEALRSK 99 K++RR + A + K IE+ +E E K Q ++ Q+ E RI EE + Sbjct: 280 KEKRRLAEAERLTALAKAKEIEEARRMEEEAKRQAEEELRKQQEKERQRIEEEARLKAEE 339 Query: 100 YDALKRFATMKSIPLPAELD 119 + ++ A ++ AELD Sbjct: 340 EERRRKEAEAEAAAQIAELD 359 >SB_45073| Best HMM Match : ERM (HMM E-Value=0) Length = 504 Score = 31.1 bits (67), Expect = 0.26 Identities = 18/69 (26%), Positives = 32/69 (46%) Query: 29 KMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNR 88 +M+ R++ VR ++ R L A + + +E + E +M Q+E R Sbjct: 281 QMKAQAREEKVRREKERNALVKEAEARTKAENDRKLLEEKLKQSEAEKEEMRAAQEEERR 340 Query: 89 IREEIEALR 97 I+EE+E R Sbjct: 341 IKEELEKER 349 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 30.3 bits (65), Expect = 0.46 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Query: 55 ASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 A R+ ++ K+E E EK +E L+Q NNR++E+ E + LK+ Sbjct: 350 AESRLTELQHKNEQEQEKMKE-----LIQQHNNRLKEKQEDHQKNLAKLKK 395 Score = 26.6 bits (56), Expect = 5.7 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 11/74 (14%) Query: 31 RGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRI- 89 + L ++ +MK++ R +K +++ +K +LE + Q DME ++ NR+ Sbjct: 1339 KSLLDQKVSQMKEKVRGIKKEFE------EKLAEKSKLEEQLKQRLLDME--KESQNRLL 1390 Query: 90 -REEIEA-LRSKYD 101 RE+ EA L+ K+D Sbjct: 1391 EREKAEADLKEKFD 1404 >SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1312 Score = 30.3 bits (65), Expect = 0.46 Identities = 17/61 (27%), Positives = 29/61 (47%) Query: 58 RIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMKSIPLPAE 117 ++ +I ELE EK + D+E +++ + E R+ + AL R A+ P E Sbjct: 962 KLNQIRIMSELEKEKKKMQEDVEKLKEAKKHREKMREEFRASFSALGRKASNMDDPSKKE 1021 Query: 118 L 118 L Sbjct: 1022 L 1022 Score = 27.5 bits (58), Expect = 3.2 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 6/65 (9%) Query: 43 QRRRTLKNRGYAASCRIKRI--EQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 QR RT+ NR +I E + E+E S H +E E+N+ EE+ +LR+K Sbjct: 650 QRARTIVNRAIINEDPNAKIIRELRAEIERLNSLGGHTVE----ESNKALEEVASLRNKL 705 Query: 101 DALKR 105 +R Sbjct: 706 QETQR 710 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 30.3 bits (65), Expect = 0.46 Identities = 24/123 (19%), Positives = 62/123 (50%), Gaps = 14/123 (11%) Query: 11 ISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELEN 70 ++D+EL+++ R+L +++I +++ + + I I K++ E Sbjct: 1132 VTDEELLNLK-RELMNTKNALEAAQNKIRSLEENLKNSQTNVNKLEVTISNIG-KEQQER 1189 Query: 71 EKSQEWHDM---------ELMQDENNRIREEIEALRSKYDALK---RFATMKSIPLPAEL 118 E++ HD + QD+ NR+++E+++ +++Y+ L+ R +++ L A++ Sbjct: 1190 ERASATHDTRYYEIETLYKASQDKENRMKQELQSYKNRYEKLESDYRKLQQENVDLRAKV 1249 Query: 119 DIL 121 + L Sbjct: 1250 NAL 1252 Score = 29.1 bits (62), Expect = 1.1 Identities = 18/82 (21%), Positives = 42/82 (51%), Gaps = 11/82 (13%) Query: 35 RDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWH-----------DMELMQ 83 R+Q R+K L+N+ +A R +R+E + + + + D++ ++ Sbjct: 2323 REQNSRLKIEIDDLRNKLSSAKSRYERVETETTIVRDAGGQLESGVDMFPDMQEDVDALK 2382 Query: 84 DENNRIREEIEALRSKYDALKR 105 E NR+ ++I + ++KY+ L++ Sbjct: 2383 AEKNRLNDDISSWQNKYNTLQK 2404 Score = 28.3 bits (60), Expect = 1.9 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 59 IKRIEQKDE-LENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 I +E ++ L +K + +HD E + +N+ ++ E+EA R D L+ Sbjct: 2427 IDHLENANQGLTTDKGKLYHDFENAKRKNHDLQAELEAARQSKDNLQ 2473 Score = 26.6 bits (56), Expect = 5.7 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 5/69 (7%) Query: 40 RMKQRRRTLKNRGYAASCRIKRIEQ-KDELENEKSQEWHDMELMQDENNRIREEIE--AL 96 +++Q L+ + A + RI+ +E KD E EK EL+Q N+ EIE + Sbjct: 1237 KLQQENVDLRAKVNALNKRIRDLEAAKDRAEKEKQAIKE--ELVQANNDLADLEIEHDTV 1294 Query: 97 RSKYDALKR 105 + YD+LK+ Sbjct: 1295 QKDYDSLKK 1303 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 30.3 bits (65), Expect = 0.46 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Query: 29 KMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNR 88 +MR L ++ R +Q+ K R + + E K E E + + +++L++DE+ + Sbjct: 627 EMRKLEEERTERDRQKEEERKRREEEEKKK-REDEVKREEEGRRQKVEAELKLIEDEHKQ 685 Query: 89 IREEIEALRSKYDALKR 105 EE+E K + KR Sbjct: 686 RLEELEKKTKKEEEKKR 702 Score = 27.5 bits (58), Expect = 3.2 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Query: 54 AASCRIKRIE-QKDELENE--KSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMK 110 AA R K IE +K E+++E K +E Q E R R E E + + D +KR + Sbjct: 609 AAEERKKEIENKKKEIDDEMRKLEEERTERDRQKEEERKRREEEEKKKREDEVKREEEGR 668 Query: 111 SIPLPAELDIL 121 + AEL ++ Sbjct: 669 RQKVEAELKLI 679 >SB_43986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 29.9 bits (64), Expect = 0.61 Identities = 18/74 (24%), Positives = 35/74 (47%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 +K+ LK +IK +E+K + + + + +EN E IE L++K Sbjct: 35 LKEEVGDLKRAFSVQEAQIKDLEKKSVALDTRVSTLGKLVVRVEENAANEEYIEKLKAKL 94 Query: 101 DALKRFATMKSIPL 114 D+L+++ SI + Sbjct: 95 DSLEQYTRKNSIEI 108 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 29.9 bits (64), Expect = 0.61 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 3/77 (3%) Query: 45 RRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 + T++ A + I+ K ELEN+K Q + E + ++E+ E L SK+ A + Sbjct: 1148 KETIEKDEKMAKLKQVAIKAKKELENQKKQAQLEKEELISVIEGMKEDAETLNSKF-AQQ 1206 Query: 105 RFATMKSI--PLPAELD 119 + T + I L A+LD Sbjct: 1207 QDETRQEIFQELQAQLD 1223 Score = 29.5 bits (63), Expect = 0.80 Identities = 21/95 (22%), Positives = 50/95 (52%), Gaps = 2/95 (2%) Query: 12 SDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELE-N 70 ++ E + +RDL +LK+ + + + Q + K++ AA +K+ ++ +L N Sbjct: 118 AEKEKAANLIRDLREELKLSVVREQEKQKHLQHMKAEKDKVQAAYNALKKQWEEHKLTCN 177 Query: 71 EKSQEW-HDMELMQDENNRIREEIEALRSKYDALK 104 + +QE + ++ + D+ + ++I+ L + ALK Sbjct: 178 KSNQELVNKVKSLNDDKQKHMKQIKLLTEQKRALK 212 Score = 27.1 bits (57), Expect = 4.3 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Query: 42 KQRRRTLKNRGYAASCRIKRIEQKD---ELENEKSQEW-HDMELMQDENNRIREEIEALR 97 K + + L A S + K IE + E NEK Q+ D+ + + + EIE+LR Sbjct: 826 KVKSKELDEIKEALSIKDKDIENYNLVIESLNEKLQQGTQDLVASNEHSKSQQSEIESLR 885 Query: 98 SKYDALKRF 106 S+ ++L +F Sbjct: 886 SQIESLNKF 894 >SB_16649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 483 Score = 29.9 bits (64), Expect = 0.61 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Query: 82 MQDENNRIREEIEALR---SKYDALKRFATMKSIPL-PAELDILP 122 ++ EN R+R+E++ LR + D L +F ++S L P + DI P Sbjct: 177 LEKENTRLRQEVDNLRKMQQQTDTLSQFIRLQSTKLKPGDKDIQP 221 >SB_4107| Best HMM Match : M (HMM E-Value=8e-22) Length = 2039 Score = 29.9 bits (64), Expect = 0.61 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 6/81 (7%) Query: 24 LNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQ 83 LN+ + R D++V Q RR ++ + ++ ++K+EL EKS + + Sbjct: 753 LNQTTRERDNLHDELV---QTRREVERQSTNV---VRLAKEKEELTREKSSLTVQVNSSE 806 Query: 84 DENNRIREEIEALRSKYDALK 104 EN + E I +++S+ ++L+ Sbjct: 807 RENRALAENIASMKSEKESLE 827 >SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) Length = 382 Score = 29.9 bits (64), Expect = 0.61 Identities = 15/59 (25%), Positives = 32/59 (54%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSK 99 +K+ R+ KNR A+ CR K++E++ +LE Q + + +R+++ L+ + Sbjct: 305 VKRERKKQKNRVAASKCRRKKLEREAQLEVRVQQLKEKSIELNAVASALRQQVGELKQR 363 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 29.9 bits (64), Expect = 0.61 Identities = 17/66 (25%), Positives = 38/66 (57%), Gaps = 5/66 (7%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQE----WHD-MELMQDENNRIREEIEA 95 ++ + LKN+ + R +R+E+ +LE E+S++ W+D M ++ + R +E + Sbjct: 3090 LRSENKDLKNKCALITQRAERLEETVQLEREESEKTIGNWNDKMMELKSQFTRTSDERDD 3149 Query: 96 LRSKYD 101 L++K + Sbjct: 3150 LKAKLE 3155 Score = 25.8 bits (54), Expect = 9.9 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 8/95 (8%) Query: 11 ISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELEN 70 +S +++ + ++L K +TR + R ++R L+ IK++E K + Sbjct: 3011 LSSEQMANSLKQELMTTNKDLAITRSTLERSQKREEELQE-------DIKQMEDKIAIIE 3063 Query: 71 EKSQEW-HDMELMQDENNRIREEIEALRSKYDALK 104 EK QE Q++ + I++LRS+ LK Sbjct: 3064 EKKQEMVEKFWKSQNDLSEAESTIDSLRSENKDLK 3098 >SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) Length = 495 Score = 29.9 bits (64), Expect = 0.61 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 2/85 (2%) Query: 21 VRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDME 80 VR+L +LK+ G + Q+V + + + K + R+ + + + E M Sbjct: 401 VRELENRLKVGGRSIQQLV-ISEEKYCDKEDEFRHRIRLLKANLAATILRAEESERRCMR 459 Query: 81 LMQDENNRIREEIEALRSKYDALKR 105 L + EN+ + EE A + YD +++ Sbjct: 460 L-ERENDMVEEETRAYKKNYDMMQK 483 >SB_11160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 29.9 bits (64), Expect = 0.61 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Query: 32 GLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENN 87 G+T Q+ Q RRT + +AA IKR K+ NE S E D E Q+ ++ Sbjct: 173 GMTESQVKVWFQNRRTKWRKRHAAEMNIKR---KEISGNESSHEESDNEGAQENDS 225 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.5 bits (63), Expect = 0.80 Identities = 13/57 (22%), Positives = 34/57 (59%) Query: 42 KQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRS 98 +++R+ ++N+ A R+K+ +++ L +E + + ++DE + +EIE L++ Sbjct: 447 QRQRKRVQNKDAATRYRVKKKDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLKN 503 Score = 29.5 bits (63), Expect = 0.80 Identities = 14/52 (26%), Positives = 33/52 (63%), Gaps = 7/52 (13%) Query: 60 KRIEQKD-------ELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 KR++ KD + ++E+S+ + + E ++ ENN++++E+ +L + + LK Sbjct: 451 KRVQNKDAATRYRVKKKDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLK 502 >SB_17268| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.7) Length = 434 Score = 29.5 bits (63), Expect = 0.80 Identities = 19/73 (26%), Positives = 34/73 (46%) Query: 22 RDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMEL 81 R R +K RD+ +Q +NR R+++ +++ +E +K QE + Sbjct: 171 RATQRYIKEFKTKRDEWKAREQELMEEENRRILEFARLQQQREEERMEKKKEQEEAMATV 230 Query: 82 MQDENNRIREEIE 94 Q + RIR+E E Sbjct: 231 QQKLSERIRKEEE 243 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 29.5 bits (63), Expect = 0.80 Identities = 15/50 (30%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Query: 60 KRIEQ-KDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFAT 108 KR+++ K+E+EN K + + + ++D+ N++ E +E + + LK AT Sbjct: 1233 KRLQELKEEVENLKRKNGIEEKRLRDDINKLSETLEKEKRMVNQLKNEAT 1282 Score = 29.1 bits (62), Expect = 1.1 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 3/105 (2%) Query: 19 ISVRDLNRQLKMR-GLTRDQIV-RMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEW 76 + +++LN ++ R L D+I + +R LK+ + A R + E K E + Q Sbjct: 561 LEIQELNIEMSKRFELEEDKIEDNFEFEQRKLKDN-HRAVLRERENEMKGLKEMYEEQIA 619 Query: 77 HDMELMQDENNRIREEIEALRSKYDALKRFATMKSIPLPAELDIL 121 E + E +R + KY ALKR MK L E+ L Sbjct: 620 QLKESVLQEKDRYNQLETDCTKKYSALKRTGDMKIDELKEEISAL 664 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 29.5 bits (63), Expect = 0.80 Identities = 15/42 (35%), Positives = 23/42 (54%) Query: 58 RIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSK 99 R K E+K +LE +K +E D + E RI+EE L+ + Sbjct: 413 RRKEQEEKRKLEEQKRKEEEDRRRKEAEEKRIKEEEARLKEE 454 >SB_41032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.5 bits (63), Expect = 0.80 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 9/83 (10%) Query: 23 DLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELM 82 + N + LT ++ R K RR+ +N+ A+ CR+KR E L + S+E + Sbjct: 69 EYNSSPQYEELTPEEETRRKVRRQ--RNKVAASKCRLKRREHVKNL-LKASEE------L 119 Query: 83 QDENNRIREEIEALRSKYDALKR 105 + N+++ +I L ++ + L+R Sbjct: 120 ESANSKLESDIACLNAEKEQLER 142 >SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 29.5 bits (63), Expect = 0.80 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Query: 31 RGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELE-NEKSQEWHDMELMQDENNRI 89 R L +++ +++ R L+ R A R+K EQ++ + E +E + ++DE R Sbjct: 305 RDLDEEELAEKRRQERKLRERDQAYYERLKVWEQRERKKAREYDREQEKEQEIKDEQARE 364 Query: 90 REEIEALRSKYD 101 R+ + YD Sbjct: 365 RKHLLEFLEDYD 376 >SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 29.1 bits (62), Expect = 1.1 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 54 AASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEAL-RSKYDALKRFATMKS 111 +AS R + + +L++ K Q ++ M D+ +R E+E++ + K D K+F T S Sbjct: 250 SASARDDLDQLQQQLKHIKEQHITEISAMDDKMKSLRLELESVSKQKNDLSKQFETQSS 308 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 29.1 bits (62), Expect = 1.1 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEI 93 ++QRR +++ S +KR ++DEL N + + W M+ N REE+ Sbjct: 206 LEQRRSSIEQNNKEYS-ELKR--KRDELTNTRKELWRQEAAMEQTINTAREEL 255 >SB_9049| Best HMM Match : SMC_C (HMM E-Value=0.0098) Length = 661 Score = 29.1 bits (62), Expect = 1.1 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Query: 28 LKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENN 87 +K L D +K K R ++ K +K++LEN+ + + ++DE Sbjct: 396 VKRTRLAEDFKDAIKDCMAVCKERVLSSFQHAKVNMEKNKLENQCRESQENYARLEDEYR 455 Query: 88 RIREEIEALRSKYDALKRFA-TMKSIPL 114 + + +EA +SK LK+ A + IP+ Sbjct: 456 QAQASLEAQKSKARNLKQVAHQLTGIPM 483 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 29.1 bits (62), Expect = 1.1 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 3/71 (4%) Query: 23 DLNRQLK--MRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDME 80 D NR+++ + G R+ IVR +++ + S K ++++ NE SQE H+++ Sbjct: 191 DQNREVEGVVTGSIRENIVRNSLNTNSIETETHKNSLETKSNDEENSNFNENSQE-HNID 249 Query: 81 LMQDENNRIRE 91 +E+++ +E Sbjct: 250 SDVEESSKNKE 260 >SB_56150| Best HMM Match : Psf2 (HMM E-Value=1.7) Length = 873 Score = 29.1 bits (62), Expect = 1.1 Identities = 13/36 (36%), Positives = 21/36 (58%) Query: 4 SPTPCAEISDDELVSISVRDLNRQLKMRGLTRDQIV 39 +PTPC EIS+ +++ +S D K+R + IV Sbjct: 498 APTPCLEISEGQVLRVSADDPQIVSKLRAAVQAGIV 533 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 29.1 bits (62), Expect = 1.1 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 16/127 (12%) Query: 9 AEISDDELVSISVRDLNRQLKMRGLTRDQ------IVRMKQRRRTLKN---RGYAASCRI 59 AE+ +D+L R+L Q +R Q I ++R++ LK R R+ Sbjct: 151 AELIEDKLAEEKARELAHQEMLRKEQEQQEEEERRIREEEERQKALKEERMRKLQEEARL 210 Query: 60 ---KRIEQKDELENE-KSQEWHDMELMQDENNR---IREEIEALRSKYDALKRFATMKSI 112 + +E+K +LE E K QE + EL + E R R + E R++ +A ++ K+ Sbjct: 211 AAQRALEEKRKLEEERKEQERKEKELAELEKKRQEERRRQEEKRRAEEEAKRKAEEEKAA 270 Query: 113 PLPAELD 119 AE++ Sbjct: 271 REKAEME 277 Score = 26.6 bits (56), Expect = 5.7 Identities = 12/51 (23%), Positives = 26/51 (50%) Query: 42 KQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREE 92 ++R R R R + +++ E+E+ + H+M+ ++DE R E+ Sbjct: 420 EERLRVEAERQREEDERQRAEDERQRAEDERQRVKHEMQRLKDERRRAEED 470 >SB_31403| Best HMM Match : PAN (HMM E-Value=2.7e-18) Length = 1051 Score = 29.1 bits (62), Expect = 1.1 Identities = 11/40 (27%), Positives = 25/40 (62%) Query: 62 IEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYD 101 ++Q+DELEN +++ ++E + + + E+E R +Y+ Sbjct: 211 VQQRDELENTVNKKQDEIEALNAKLEILTREVEEERHRYE 250 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 29.1 bits (62), Expect = 1.1 Identities = 18/84 (21%), Positives = 33/84 (39%) Query: 27 QLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDEN 86 +LK RD + QR R + IK ++ + + W M QD Sbjct: 42 ELKAELHKRDDLEPAGQRHRHDSGESFEEHEEIKSLKNEIVRLQTECHHWKSMSSNQDSQ 101 Query: 87 NRIREEIEALRSKYDALKRFATMK 110 ++ EI+ +++ AL+ + K Sbjct: 102 KKLHREIDQYQNELSALQNTYSQK 125 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 29.1 bits (62), Expect = 1.1 Identities = 13/48 (27%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Query: 58 RIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 +++ IE K++ E + H+ME + +EN +R++ E + K + + R Sbjct: 761 QVELIEAKEDTEKVR----HEMEGITEENETLRKKFETQKEKIEGMSR 804 Score = 28.7 bits (61), Expect = 1.4 Identities = 18/96 (18%), Positives = 49/96 (51%), Gaps = 2/96 (2%) Query: 10 EISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELE 69 +I+ +EL + + L + +G +++++ K + + R++ ++ K + Sbjct: 1397 QIAQNELKELRCQ-LEKNETDKGQLEEELIKTKDALLEKYDAMLSLQRRVQELQYKWDQH 1455 Query: 70 NEKSQEWH-DMELMQDENNRIREEIEALRSKYDALK 104 E+ QE ++ + DE N + +++ALR++ + L+ Sbjct: 1456 VEEIQEKDTSIKTLNDEKNNLTIDMDALRNEVETLR 1491 Score = 26.6 bits (56), Expect = 5.7 Identities = 13/63 (20%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Query: 42 KQRRRTLKNRGYAASCRIKRIE-QKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 K R+ +++ + R++ Q + L +K ++ ++ENN+ REE+ + + Sbjct: 28 KMYRKEVEDLRDKQKVEVSRLQLQIESLSKQKQHFQEQFKISKNENNKYREELNKAQQQL 87 Query: 101 DAL 103 + L Sbjct: 88 ELL 90 >SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) Length = 1293 Score = 29.1 bits (62), Expect = 1.1 Identities = 18/84 (21%), Positives = 33/84 (39%) Query: 27 QLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDEN 86 +LK RD + QR R + IK ++ + + W M QD Sbjct: 18 ELKAELHKRDDLEPAGQRHRHDSGESFEEHEEIKSLKNEIVRLQTECHHWKSMSSNQDSQ 77 Query: 87 NRIREEIEALRSKYDALKRFATMK 110 ++ EI+ +++ AL+ + K Sbjct: 78 EKLHREIDQYQNELSALQNTYSQK 101 >SB_286| Best HMM Match : M (HMM E-Value=0.39) Length = 414 Score = 29.1 bits (62), Expect = 1.1 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 4/76 (5%) Query: 29 KMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNR 88 + +G TR + R K R +++G A +KR K+ L++E+S+E E + N Sbjct: 3 RSKGNTRRE--RSKGNTRRERSKGNAQKGMLKRERSKETLKSERSKETLKREC--SKGNA 58 Query: 89 IREEIEALRSKYDALK 104 + ++ RSK +A K Sbjct: 59 QKRTLKRERSKGNAQK 74 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 28.7 bits (61), Expect = 1.4 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query: 67 ELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFAT---MKSIPLPAELDIL 121 +L+ E S H+++ + E ++ + L+ KYD L T + L ELDI+ Sbjct: 2339 DLQKELSSRTHELQKVSSEKGKLEAAFDILQKKYDDLMEERTELIEEKETLVKELDIM 2396 Score = 28.3 bits (60), Expect = 1.9 Identities = 18/70 (25%), Positives = 37/70 (52%), Gaps = 1/70 (1%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDE-LENEKSQEWHDMELMQDENNRIREEIEALRSK 99 +K+ L+N A + ++ +E ++E LE+EK + D + E+ +R +EAL ++ Sbjct: 1864 LKKENDRLQNEISAINRKLVYLETRNENLESEKDRLKKDFANSKKESAELRARLEALLNE 1923 Query: 100 YDALKRFATM 109 L+ T+ Sbjct: 1924 KSRLQNEVTL 1933 Score = 26.2 bits (55), Expect = 7.5 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query: 62 IEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK-RFATMK 110 I Q ELE++ + H +E ++ N++R+E L S + K + T+K Sbjct: 1816 ILQGQELESKAADLEHRLETEANDKNKLRQENITLASSLNEYKVNYLTLK 1865 Score = 25.8 bits (54), Expect = 9.9 Identities = 26/112 (23%), Positives = 55/112 (49%), Gaps = 12/112 (10%) Query: 13 DDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEK 72 D+ ++ V++L L D+I +K+ +K A + R K +E +DE+ + Sbjct: 698 DNSVLESEVKELTAH---ENLLVDEIENLKRELGEVKRT--AENLR-KDLEGRDEVIKQL 751 Query: 73 SQEWHDMELMQDENNRIREEIEALRSKYDALK---RFATMKSIPLPAELDIL 121 + ++ + +EN+ ++ E+E+L+ Y+ L+ R K + EL +L Sbjct: 752 RPK---VKELLEENDSLKVELESLKQSYEDLEEQYRVVEDKYLSAQKELKVL 800 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 28.7 bits (61), Expect = 1.4 Identities = 13/46 (28%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Query: 60 KRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 K+ ++++ELE K QE ME+ + E ++++ ++ LR K + ++ Sbjct: 172 KKRKEEEELERRKHQE--RMEIQRREAEKVKQMMDELRKKEERRRK 215 >SB_18803| Best HMM Match : KE2 (HMM E-Value=1.5) Length = 244 Score = 28.7 bits (61), Expect = 1.4 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 7/111 (6%) Query: 5 PTPCAEISDDELVSISVRD--LNRQLKMRGLTRDQIVRMKQ---RRRTLKNRGYAASCRI 59 PTP + S+++ ++ +R ++ R R+KQ + L A R+ Sbjct: 133 PTPPTDTSEEQTRENLIKSHFTSRITELSSQCRSLYKRIKQADKNKSDLSMELQVAKGRV 192 Query: 60 KRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMK 110 K I+ DELE K + +M + + E++ + + +ALK AT K Sbjct: 193 KEIQ--DELEVTKRNYETQLSMMSEHLCGMNEKLTTQQDEIEALKGRATKK 241 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 28.7 bits (61), Expect = 1.4 Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREE 92 EQK E++ E+ QE E+ +++ ++EE Sbjct: 25 EQKQEVQEEQKQEEQKQEVQEEQKQEVQEE 54 Score = 26.6 bits (56), Expect = 5.7 Identities = 9/30 (30%), Positives = 19/30 (63%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREE 92 EQK E++ E+ QE + + +++ ++EE Sbjct: 86 EQKQEVQEEQKQEEQEEQKQEEQKQEVQEE 115 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/59 (20%), Positives = 31/59 (52%) Query: 34 TRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREE 92 T+++ +Q+ + L+ + + + EQK E + ++ QE E+ +++ ++EE Sbjct: 4 TKEEKQEEQQQNQELEEQQQKEQKQEVQEEQKQEEQKQEVQEEQKQEVQEEQKQEVQEE 62 >SB_48387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 941 Score = 28.7 bits (61), Expect = 1.4 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 8/88 (9%) Query: 19 ISVRDLNRQLKMRGLTRDQIVRM----KQRRRTLKNRGYAASCRIKRIE--QK--DELEN 70 + + +LN +K L + + R + R T ++R Y + + +I QK ELE+ Sbjct: 852 MKIHELNNNIKNEALYQSTMARKDTAGQGRVETDRDRQYMDNVSLDKIRNAQKRASELES 911 Query: 71 EKSQEWHDMELMQDENNRIREEIEALRS 98 + QE H+ E R+R E+ +S Sbjct: 912 QLEQERHERLKQHAELARVRAELSVAKS 939 >SB_18608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 28.7 bits (61), Expect = 1.4 Identities = 16/90 (17%), Positives = 44/90 (48%), Gaps = 3/90 (3%) Query: 21 VRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDME 80 + L R + L +++ + + + + A ++++ + +D+L + ++ E Sbjct: 103 IEQLQRTKESMELQLEELRHSIKEKDDVNRKMSAEKIKLQQGQLRDQLRQQMTKR---AE 159 Query: 81 LMQDENNRIREEIEALRSKYDALKRFATMK 110 L+++E + + +E L+SK L++ T K Sbjct: 160 LLEEERRKAGQSLEGLKSKLKNLEQVITRK 189 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 28.7 bits (61), Expect = 1.4 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Query: 21 VRDLNRQLKMRGLTRDQIVR-MKQRRRTLKNRGYAASCRIKRIEQK-DELENEKSQEWHD 78 V+ +N LK R + I+ +K + L+ + S +I +E K LE EK+ + Sbjct: 265 VKKIN-DLKKRITELELIINTLKDEKEALEQDVNSMSYKISNLETKVKNLEKEKAFYQKE 323 Query: 79 MELMQDENNRIREEIEALRSK 99 E ++ +N R++ EI L+++ Sbjct: 324 SEELEAKNRRMKNEILQLQNQ 344 Score = 27.9 bits (59), Expect = 2.4 Identities = 13/43 (30%), Positives = 24/43 (55%) Query: 62 IEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 IE++ E E + D++ ++DE + I L+ K++ALK Sbjct: 647 IEKRKHAEQESDELEADLQKLKDELASTKRHIADLQDKHEALK 689 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/55 (20%), Positives = 31/55 (56%) Query: 67 ELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMKSIPLPAELDIL 121 +L+++ +++ +DEN+ +R++ + L ++ + LKR + +P + I+ Sbjct: 680 DLQDKHEALKDELDKTEDENDALRDKKKELEAEIEELKRKLAESELNIPIQQPIV 734 Score = 26.2 bits (55), Expect = 7.5 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 3/75 (4%) Query: 45 RRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 +++LKN+ + R+ E +DEL N Q + ++ D + + + + EAL K A K Sbjct: 510 KKSLKNQLDKVNKRVT--EHQDELMN-LDQSLVEHKIAVDAHTKEKTQREALLDKLRATK 566 Query: 105 RFATMKSIPLPAELD 119 + ++ L A LD Sbjct: 567 DYLEEQNESLKASLD 581 >SB_9039| Best HMM Match : M (HMM E-Value=0.00046) Length = 716 Score = 28.7 bits (61), Expect = 1.4 Identities = 10/43 (23%), Positives = 25/43 (58%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 E+ ++E K + +++ + +R+ +I +RS+YD ++R Sbjct: 593 EEMQQIERRKKELQEEVDKLSGLRDRLSHDIADMRSRYDQMQR 635 >SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) Length = 275 Score = 28.3 bits (60), Expect = 1.9 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 7/73 (9%) Query: 42 KQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYD 101 K+R R +N+ A CR +R E ELE E E ++D N + EI L + Sbjct: 175 KRRIRRERNKLAAFKCRQRRKEHIQELEIES-------EGIEDSNKELEREISELHEQRQ 227 Query: 102 ALKRFATMKSIPL 114 L+ S L Sbjct: 228 QLEEMLKTHSCKL 240 >SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) Length = 1231 Score = 28.3 bits (60), Expect = 1.9 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 11/82 (13%) Query: 13 DDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEK 72 DD S RD+ + + L++ RM+++RR + R K + +E+E EK Sbjct: 901 DDCKKSTLERDMTPRTMRKSLSKSTRERMERKRREEEERA-------KEQMRIEEIEQEK 953 Query: 73 SQEWHDMELMQ-DENNRIREEI 93 S++ ++L Q +E +R+R++I Sbjct: 954 SKQ---LQLQQKEEEDRLRKKI 972 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 28.3 bits (60), Expect = 1.9 Identities = 13/55 (23%), Positives = 30/55 (54%) Query: 43 QRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALR 97 + ++ L++R R K +Q+ E E+ + W + + ++EN ++R++ E R Sbjct: 1084 KEQQELESRISLERLRYKEEQQRLRDEEEQQRAWLEKKFQREENQQLRQQKEEER 1138 >SB_57947| Best HMM Match : DSHCT (HMM E-Value=1.2e-08) Length = 183 Score = 28.3 bits (60), Expect = 1.9 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 16 LVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQE 75 +VS +R ++LK R T Q+ +K R+R L+ GYA + + ++ + E E Sbjct: 63 MVSNEIRAARKELK-RARTILQLDELKCRKRVLRRLGYATASDVIEVKGRVACELSSGDE 121 >SB_32857| Best HMM Match : TolA (HMM E-Value=1.1) Length = 448 Score = 28.3 bits (60), Expect = 1.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREE 92 +++DE N+K ++ HD E +E NR E+ Sbjct: 190 DRRDEERNKKDEDRHDKERSNEEENRHDEK 219 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 27.9 bits (59), Expect = 2.4 Identities = 21/104 (20%), Positives = 48/104 (46%), Gaps = 2/104 (1%) Query: 12 SDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELEN- 70 +++++ + R L+ +K R + + M+ +TLK+ R K+ + K E N Sbjct: 947 AEEKIEDLEAR-LDEAIKRRTSAEEDLDDMQTELQTLKDEMAEGQRRYKKQQDKLEALNV 1005 Query: 71 EKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMKSIPL 114 E ++E +E +++ ++ +I L K + M+ I + Sbjct: 1006 ELTKEHEYVEELRENRRKLEAKINELEQKLASQADIIPMQPIQI 1049 >SB_46257| Best HMM Match : Mod_r (HMM E-Value=1.2) Length = 140 Score = 27.9 bits (59), Expect = 2.4 Identities = 14/37 (37%), Positives = 23/37 (62%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREEIEALRSK 99 E+KDELEN ++E M+ ++ + +EI LR+K Sbjct: 60 ERKDELENGLYWVRKELEDMRSQDRTLAKEIIGLRTK 96 >SB_34153| Best HMM Match : DUF972 (HMM E-Value=0.17) Length = 473 Score = 27.9 bits (59), Expect = 2.4 Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 11/98 (11%) Query: 17 VSISVRDLNRQLKMRGLTRD----QIVRMKQRRRTLKNRGYAASCRI--KRIEQKDEL-- 68 ++I +L QLK + D QI ++ R L + Y + +I KR D++ Sbjct: 356 LTIETEELREQLKEQHSAVDGWNTQIQQLTDERDNLAQQ-YEEAAKIAEKRKSMLDQMAI 414 Query: 69 ENEKSQEWHD--MELMQDENNRIREEIEALRSKYDALK 104 E ++ + H +E +Q+E+ ++R+E+E L K + K Sbjct: 415 ERQEIETAHREAVERIQEEHRKLRKEVEDLHQKLNENK 452 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 27.9 bits (59), Expect = 2.4 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 4/79 (5%) Query: 31 RGLTRDQIVRMKQRRRT---LKNR-GYAASCRIKRIEQKDELENEKSQEWHDMELMQDEN 86 RG++ ++ RRT NR G A + +EQ + +K+Q+ D++ +++ N Sbjct: 857 RGVSTGRVNPSTAERRTKSRFTNRAGKAENMEHVNMEQVSDASQKKTQDKRDVKGLKEPN 916 Query: 87 NRIREEIEALRSKYDALKR 105 + E+ + DA +R Sbjct: 917 QEVLEDSTEVSGNSDASQR 935 >SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 27.9 bits (59), Expect = 2.4 Identities = 15/60 (25%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENE-KSQEWHDMELMQDENNRIREEIEALRSK 99 +K+ R+ +NR ++ CR +++E++ LEN K + ++EL N +++++ L+ + Sbjct: 474 VKRERKKQRNRIASSKCRKRKLEREARLENRVKDLKERNIEL-NAVANALKQQVCDLKQR 532 >SB_43065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 27.9 bits (59), Expect = 2.4 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 2/92 (2%) Query: 15 ELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQK-DELENEKS 73 EL IS++ N K+R TRD R + R ++ A R E++ E N+ Sbjct: 397 ELDQISLKTQNELEKIRSDTRDMYDRENRNLRESRDNAEAEKQRAVNSEKEITERHNQLL 456 Query: 74 QEWHDMELMQD-ENNRIREEIEALRSKYDALK 104 E+ +++ D + + E++ + + D L+ Sbjct: 457 AEFSQLQVTSDGRQSELLNELKLKQFEVDRLQ 488 >SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 27.9 bits (59), Expect = 2.4 Identities = 13/39 (33%), Positives = 21/39 (53%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYD 101 E+K++ EN + W + E R +EEI+ LR+ D Sbjct: 205 EEKEKGENRDERRWIEKENRAMRQKRKKEEIKRLRTLVD 243 Score = 27.9 bits (59), Expect = 2.4 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 3/82 (3%) Query: 43 QRRRTLKNRGYAASCRIKRI--EQKDELENEKSQEWHDMELMQDENNRIREE-IEALRSK 99 +R RTL + YA RIK+ E+K+ EK + + +E R R+E +EA R Sbjct: 236 KRLRTLVDNVYACDPRIKKFKEEEKERKLAEKKAKEDAAKAAAEEKERQRQEALEAERLA 295 Query: 100 YDALKRFATMKSIPLPAELDIL 121 + ++ A K+ E + L Sbjct: 296 KEKEEQLAKEKATQAKKEKEKL 317 >SB_39000| Best HMM Match : TolA (HMM E-Value=0.55) Length = 576 Score = 27.9 bits (59), Expect = 2.4 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Query: 40 RMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEAL 96 + KQ +R LK G A + EQ+ E +K +W + + ++ ++ R+ E+EAL Sbjct: 307 KTKQEKR-LKEIGLA---ELFEEEQRKRDEAKKRNDWLEQQRLEADSKRLEMEMEAL 359 >SB_17789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.9 bits (59), Expect = 2.4 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 7/64 (10%) Query: 33 LTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREE 92 LT+ Q +K+ RR +KN+ A R K+ E + LE +E ENN +R+ Sbjct: 155 LTKTQERALKRIRRKIKNKLSAQESRRKKKEYVETLEKR-------LESFILENNTLRDR 207 Query: 93 IEAL 96 + +L Sbjct: 208 VSSL 211 >SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) Length = 976 Score = 27.9 bits (59), Expect = 2.4 Identities = 17/71 (23%), Positives = 38/71 (53%) Query: 26 RQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDE 85 R L++R + R++ V +++ + G + K E+KD+ E +K ++ + +D+ Sbjct: 419 RDLQLRKMAREEGVSIEEIEAREEAAGGDEEQKEKMKERKDKKEEKKDKDKDKDKDEEDD 478 Query: 86 NNRIREEIEAL 96 ++ EE EA+ Sbjct: 479 SSDSEEEREAM 489 >SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) Length = 298 Score = 27.5 bits (58), Expect = 3.2 Identities = 19/86 (22%), Positives = 36/86 (41%) Query: 9 AEISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDEL 68 A + D V+ V + ++K+ L + R K+RR + + KR E+K Sbjct: 62 AGVEDSSTVAYGVGEAGSKVKVTRLESMEEDREKRRREKEEEERLKRAEEEKRREEKRRE 121 Query: 69 ENEKSQEWHDMELMQDENNRIREEIE 94 E + +E Q+ + R+ +E Sbjct: 122 EKRREEELKRERKEQERREKERQRLE 147 >SB_57710| Best HMM Match : bZIP_1 (HMM E-Value=0.32) Length = 584 Score = 27.5 bits (58), Expect = 3.2 Identities = 12/40 (30%), Positives = 24/40 (60%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDA 102 E+ L NEK+Q H++E + +++EE +A+ + +A Sbjct: 126 EELTRLSNEKNQLCHELEKKSMDAAKMKEEFDAMATIREA 165 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 27.5 bits (58), Expect = 3.2 Identities = 20/91 (21%), Positives = 41/91 (45%), Gaps = 2/91 (2%) Query: 4 SPTPCAEISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIE 63 SP+ +E S LV+ L + K G +++ + R+ + +GY + K + Sbjct: 455 SPSQASE-SSPTLVTELKTQLEKLKKENGELAERLEVYELRKEQMHMQGYFDPLKTKVVH 513 Query: 64 QKDELEN-EKSQEWHDMELMQDENNRIREEI 93 N + Q +++ +QDEN +R+ + Sbjct: 514 FSMNPSNLARQQRAEEIKRLQDENEALRQRV 544 >SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 1007 Score = 27.5 bits (58), Expect = 3.2 Identities = 13/65 (20%), Positives = 35/65 (53%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 +++R++ A+CR + + K E+E + + + ++ N ++ +E+++L S Sbjct: 820 LEERKQNQNGSEELATCRSELEKAKGEIEKAWTLYDKEKDRLEKLNGQLIDELKSLTSVL 879 Query: 101 DALKR 105 D +K+ Sbjct: 880 DEMKK 884 Score = 27.1 bits (57), Expect = 4.3 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 2/79 (2%) Query: 22 RDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMEL 81 ++ +Q ++ LT + + ++ + T + + Y S + + K +LE + Sbjct: 26 KNQEQQQRIEELTCELELAYQEIKNTEERKNYENSEHVLVV--KADLERARDNYVKLAND 83 Query: 82 MQDENNRIREEIEALRSKY 100 ++ENNR+ E I AL+ Y Sbjct: 84 REEENNRLNETIRALQDDY 102 Score = 26.2 bits (55), Expect = 7.5 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 15/97 (15%) Query: 12 SDDELVSISVRDLNR----QLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDE 67 + +EL+++ DL R LK+ +++ R+ + RTL++ + + R+ +QK E Sbjct: 553 NSEELIALKA-DLERAKYDNLKLANYRKEENDRLNETIRTLQDEVKSLTTRLDETKQKSE 611 Query: 68 LENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 ++ + E + +EEIE + YD K Sbjct: 612 ----------ELAACKSELKKAKEEIEKAWTLYDKEK 638 >SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) Length = 1292 Score = 27.5 bits (58), Expect = 3.2 Identities = 27/112 (24%), Positives = 51/112 (45%), Gaps = 4/112 (3%) Query: 10 EISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELE 69 +++ + L+S+ +R +R L ++ + MK+ L+N + EQ L+ Sbjct: 732 DVAQNRLLSLQDVLSSRDESVRDLNQE-LQNMKEEHERLQNEMKLQGEELT--EQIKMLQ 788 Query: 70 NEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMKSIPLPAELDIL 121 + Q ++L QDE + E+ +S DAL+ K + +ELD L Sbjct: 789 VQLVQNDGSLKLQQDEMQKASSELLDTKSTMDALRAQLVEKQNKI-SELDSL 839 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 27.5 bits (58), Expect = 3.2 Identities = 13/51 (25%), Positives = 28/51 (54%) Query: 60 KRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMK 110 +R+ Q+D+L ++ ++ D E + E + ++ + + K D+LKR K Sbjct: 978 ERLLQEDKLHEKEEKDRKDKEKRKVEKEKREKDKQVEKEKKDSLKRVKKRK 1028 >SB_18662| Best HMM Match : Toxin_27 (HMM E-Value=2) Length = 253 Score = 27.5 bits (58), Expect = 3.2 Identities = 14/53 (26%), Positives = 25/53 (47%) Query: 38 IVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIR 90 ++R+K LK + + R KR L+N+ S+ W + ++E R R Sbjct: 31 LLRLKANLTVLKASEWKQAIRAKRKATSKFLKNKTSENWENKRAARNEATRQR 83 >SB_18060| Best HMM Match : Pepsin-I3 (HMM E-Value=0.67) Length = 328 Score = 27.5 bits (58), Expect = 3.2 Identities = 18/85 (21%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Query: 25 NRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCR---IKRIEQKDELENEKSQEWHDMEL 81 NR++K R +T Q + K + + R ++++E +LE ++ QE Sbjct: 244 NRKIKDRDVTNTQPKKKKPSNQQILRSSEVRKRRDDELRKLELAKQLEWDRKQEEKKERK 303 Query: 82 MQDENNRIREEIEALRSKYDALKRF 106 + + R+R++ + K ++ RF Sbjct: 304 QKKKEERMRKKEQEKEEKEASISRF 328 >SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1497 Score = 27.5 bits (58), Expect = 3.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 3 LSPTPCAEISDDELVSISVRDLNRQLKMRGLTR 35 LSP AEI +D + S+ +NR KM ++R Sbjct: 197 LSPAKAAEIEEDPQLMDSIASVNRWRKMAKMSR 229 >SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) Length = 303 Score = 27.5 bits (58), Expect = 3.2 Identities = 14/66 (21%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Query: 31 RGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIR 90 + +T ++ + ++ + NR Y A+C+ + + +E EN ++++ ++EL + N R Sbjct: 97 KNITDKNELKSQVKKTKISNRAYFAACKKELRRKANEAENAENKK-KNIELKLKQKNTPR 155 Query: 91 EEIEAL 96 + E + Sbjct: 156 KWPEGM 161 >SB_396| Best HMM Match : DUF217 (HMM E-Value=4.3) Length = 262 Score = 27.5 bits (58), Expect = 3.2 Identities = 16/57 (28%), Positives = 28/57 (49%) Query: 58 RIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMKSIPL 114 +IK +E+K + + + + +EN E IE L K D+LK++ SI + Sbjct: 54 QIKDLEKKSVALDTRVSTLGKLVVRVEENAAKEEYIEKLEVKLDSLKQYTRKNSIEI 110 >SB_56664| Best HMM Match : bZIP_1 (HMM E-Value=0.00033) Length = 652 Score = 27.5 bits (58), Expect = 3.2 Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Query: 11 ISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELEN 70 +S++++V +SV + L+ + + VR +RR KN+ A CR ++++ + L++ Sbjct: 391 VSEEKIVEMSVAEFTTFLEKLSDAQAKYVRDVRRRG--KNKEAARICRKRKMDAIETLDD 448 Query: 71 E 71 E Sbjct: 449 E 449 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 27.5 bits (58), Expect = 3.2 Identities = 13/44 (29%), Positives = 24/44 (54%) Query: 62 IEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 + +K EL++ SQ + + EN+ I ++A+R K L+R Sbjct: 4140 VGEKQELQSTVSQLQRKYQTKESENSEISGRLQAVRQKIVELER 4183 >SB_50496| Best HMM Match : FHA (HMM E-Value=7.8e-07) Length = 766 Score = 27.5 bits (58), Expect = 3.2 Identities = 23/100 (23%), Positives = 53/100 (53%), Gaps = 16/100 (16%) Query: 10 EISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELE 69 E+ +++ I+ D++RQ ++ +DQ +R + ++ K IE + +L Sbjct: 412 ELQKRKIMEIAEVDIHRQRELLSWEKDQEIRDLEEQQE------------KLIELQGQLT 459 Query: 70 NEKS---QEWHDMELMQDEN-NRIREEIEALRSKYDALKR 105 + S +E+H+M+ + ++N + +EE+E + K +L+R Sbjct: 460 SSYSLTEKEYHNMKPVMEKNIKKEKEELEHIERKIRSLER 499 >SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 27.5 bits (58), Expect = 3.2 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Query: 68 LENEKSQEWHDMELMQDENN----RIRE-EIEALRSKYDALKRFATMKSIPLPAELDI 120 L +KSQE H +L++ + RE +IE L + D KR + +IP P +D+ Sbjct: 281 LSEKKSQETHLKQLLRATESIHDVMARELDIELLDLQRDITKRMEELLNIPAPNPIDL 338 >SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 27.5 bits (58), Expect = 3.2 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Query: 43 QRRRTLKNRGY---AASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIE 94 +RR ++ + Y AA+ ++++E E EK +E ++E ++E +EIE Sbjct: 11 ERRNEMEEKAYEQEAANREDNEQDEEEEEEVEKEEEEEEVEEEEEEEEEKEDEIE 65 >SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 27.1 bits (57), Expect = 4.3 Identities = 12/53 (22%), Positives = 29/53 (54%) Query: 40 RMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREE 92 + K++++ K + +I ++E+K+E E E+ + + E ++E +EE Sbjct: 115 KKKKKKKKKKKKKKINKKKINKVEEKEEGEEEEEEGEEEEEKEEEEEEDKQEE 167 >SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1) Length = 432 Score = 27.1 bits (57), Expect = 4.3 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Query: 58 RIKRIEQKDELENEKSQEWHDMELMQDENNRIR----EEIEALRSKYDALKRFATMKS 111 R ++ ++K E K E H + DE +RIR E +E L+ + +A++ T +S Sbjct: 204 RREKDDKKKSRERSKGDEEHTKDSKLDEEDRIRRREKELLETLKQEEEAVEEEDTKQS 261 >SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1260 Score = 27.1 bits (57), Expect = 4.3 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query: 62 IEQKDEL-ENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 + +KD L ENEK+Q ++ +Q E +R+ +E R + L++ Sbjct: 605 LSEKDSLYENEKTQAQMQVQQLQTETENLRKLLEDERRQKSLLEQ 649 >SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) Length = 721 Score = 27.1 bits (57), Expect = 4.3 Identities = 16/79 (20%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Query: 15 ELVSISVRDLNRQLKMRGLTRDQI-VRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKS 73 E ++ ++ R+L+ + + + R +++R+ K+R A+ R K +Q++EL E Sbjct: 32 EELAEKAKERMRKLRAKRAAKPSVQTRNEKKRQAPKDRNTASVLRAKIRKQEEELRKETQ 91 Query: 74 QEWHDMELMQDENNRIREE 92 ++ + + ++ EE Sbjct: 92 RKQARNRMQELRKRKLAEE 110 >SB_32407| Best HMM Match : WSC (HMM E-Value=0.0008) Length = 832 Score = 27.1 bits (57), Expect = 4.3 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 2/82 (2%) Query: 29 KMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNR 88 K+R L ++ +R +R R R R KRI ++++ + + ++LM E R Sbjct: 239 KLRRLKHEKHLRRLKRLREQWGRRQRQLAREKRIRRENKRKERERLRRERVKLM--ERLR 296 Query: 89 IREEIEALRSKYDALKRFATMK 110 R+ A R + + +KR MK Sbjct: 297 RRKLERARRIRKERMKRLQMMK 318 Score = 25.8 bits (54), Expect = 9.9 Identities = 16/70 (22%), Positives = 35/70 (50%) Query: 42 KQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYD 101 ++R+R R A R++++++K ELE+ + E+ + ++ N R+ + K Sbjct: 372 RERQRAGAKRRAAIRIRMEQLKRKRELEHARKIEFLRRQKLRIANEIARKLARQKQQKAR 431 Query: 102 ALKRFATMKS 111 +RF K+ Sbjct: 432 KKQRFIQRKT 441 >SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 27.1 bits (57), Expect = 4.3 Identities = 14/60 (23%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Query: 39 VRMKQRRRTLKNRGYAASC--RIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEAL 96 VR KQR +++R YAA +++ +E++ L E+ + ++ + +++ I ++ L Sbjct: 180 VRNKQREVEIEHREYAARAERKMREVEERQRLIAEEERNRQELAQLCSKHHEIHALVQKL 239 >SB_28785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 4.3 Identities = 17/52 (32%), Positives = 24/52 (46%) Query: 2 PLSPTPCAEISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGY 53 PLS P ++ + S VR+LN LK R TR+ + + R R Y Sbjct: 73 PLSGLPVSQFAKQTDTSSDVRNLNTVLKHRYYTRNTEIHLITATRWPSPRKY 124 >SB_13076| Best HMM Match : NUC202 (HMM E-Value=3) Length = 472 Score = 27.1 bits (57), Expect = 4.3 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 33 LTRDQIVRMKQ-RRRTLKNRGYAASCRIKRIEQKDELENEKSQE 75 LTR+Q + + R+ ++ R CR+K E +L EKS++ Sbjct: 93 LTREQFLALGYAERKVIQLREIVQKCRLKHKELSPKLTKEKSKK 136 >SB_45619| Best HMM Match : M (HMM E-Value=0.01) Length = 1315 Score = 27.1 bits (57), Expect = 4.3 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 59 IKRIEQKDELENEKSQEW-HDMELMQDENNRIREEIEALRSKYDALK 104 IK + ++ E E + + D+ + ++N R+R+ E L+ ++DA K Sbjct: 569 IKALRKQQENERDTIERLTSDVNNLTEDNARLRKRCENLKEEHDATK 615 >SB_30869| Best HMM Match : DUF164 (HMM E-Value=0.18) Length = 442 Score = 27.1 bits (57), Expect = 4.3 Identities = 22/91 (24%), Positives = 46/91 (50%), Gaps = 6/91 (6%) Query: 17 VSISVRDLNRQ-LKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIK-RIEQKDELENEKSQ 74 V + VR+ Q L+ + +++ K++ + + G A K R+E +D E + Q Sbjct: 161 VKLEVREREEQILEKQKFLENELDNNKEKEKKV---GAAERLAAKLRLEYQDA-ERTRIQ 216 Query: 75 EWHDMELMQDENNRIREEIEALRSKYDALKR 105 ++ ++ +R +++EA R KY+ LK+ Sbjct: 217 FQDELNTLKYTVDRTAKDLEATRQKYNELKK 247 >SB_59267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1444 Score = 26.6 bits (56), Expect = 5.7 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Query: 42 KQRRRTLKN-RGYAASCRIKRIEQKDELENEKSQE---WHDMELMQDENNRIREEIEALR 97 K RRR L + R +A EQ+ LE SQ+ + Q E R+REE+ A + Sbjct: 277 KLRRRVLSDLRRFARPNENSFQEQERHLERLISQQEAVYRQQSEQQKEQQRLREELAAQQ 336 Query: 98 SK 99 +K Sbjct: 337 NK 338 >SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/37 (27%), Positives = 23/37 (62%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREEIEALRSK 99 E+K+ + E + D+ ++E N+++E ++A+ SK Sbjct: 353 EEKNAVAKELEKREKDLMEAEEEQNKLQERLKAVESK 389 Score = 26.2 bits (55), Expect = 7.5 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 45 RRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIE 94 +R +G+A K E K ++E EK Q ++ ++E N + +E+E Sbjct: 315 KRKKNKKGHAIPPE-KIAEMKAKIEAEKLQLQEKKDMAEEEKNAVAKELE 363 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 26.6 bits (56), Expect = 5.7 Identities = 19/87 (21%), Positives = 44/87 (50%), Gaps = 2/87 (2%) Query: 24 LNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQ 83 L RQ + + R Q +M QR+R + R ++ +++E+ ++ Q+ +EL + Sbjct: 612 LQRQREEEEMRRQQ-EQMLQRQREEEERRRQQEEAERQRREQEEVFKQQEQQRQQLELQK 670 Query: 84 DENNRIREEIEALRSKYDALKRFATMK 110 + + R++ E + + + +R A M+ Sbjct: 671 RQQEQQRQQ-ELQKRQQEEKQRMAEMR 696 >SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) Length = 732 Score = 26.6 bits (56), Expect = 5.7 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Query: 60 KRIEQKDELENEKSQEWHD--MELMQDE--NNRIREEIEALRSKYDALKR 105 +R+E++ E E E+ Q+ HD M + D+ + + EE K DAL++ Sbjct: 247 ERLEKERESEEERLQKEHDAVMRTLGDKAREDTLEEEAMLQEGKQDALRK 296 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 26.6 bits (56), Expect = 5.7 Identities = 19/104 (18%), Positives = 50/104 (48%), Gaps = 2/104 (1%) Query: 10 EISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELE 69 ++ ++ L ++L +++M L ++ + R+ + + R ++ + ELE Sbjct: 1414 KVKEEALAMEVQKELEAEMEMERLQKEN-EEERLRKEEEERKMEEERRRDEQARRDKELE 1472 Query: 70 NEKSQEWHDMELMQDENNRIREEIEAL-RSKYDALKRFATMKSI 112 ++K ++ +M+ + R+E+E L R K + L+ +K + Sbjct: 1473 DQKRKDEERRLIMEQQERERRQEMEYLQREKEERLRVEEALKKL 1516 >SB_24029| Best HMM Match : Kinesin (HMM E-Value=2.10195e-44) Length = 534 Score = 26.6 bits (56), Expect = 5.7 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQ---EWHDMELMQDENNRIREEIEALR 97 MK+ + ++ R A + EQ+D+LE E +Q E D M+ E + ++ AL Sbjct: 336 MKRDNKEVQERMLALQKDKDQSEQRDKLEKENAQTLAEEVDRVKMEIEQEKAELQLSALE 395 Query: 98 SKYDALK 104 ++ LK Sbjct: 396 NEKKRLK 402 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 26.6 bits (56), Expect = 5.7 Identities = 15/63 (23%), Positives = 31/63 (49%) Query: 42 KQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYD 101 ++RRR + R + + E+K E EK +E + + ++E + +E+ E + K + Sbjct: 444 EERRREEEERREEEERKREEEERKQREEEEKKREEEERKQREEEERKQKEKEEEKKRKEE 503 Query: 102 ALK 104 K Sbjct: 504 ERK 506 >SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) Length = 1558 Score = 26.6 bits (56), Expect = 5.7 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Query: 63 EQKDELENEKSQEWHDMELMQ--DENNRIREEIEALRSK 99 E KD+L+N KS+E + +M+ + ++++EIE + K Sbjct: 571 ELKDKLKNAKSEEEKEALIMEYGQKMTKVQDEIEQQKQK 609 >SB_10762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 647 Score = 26.6 bits (56), Expect = 5.7 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 6/87 (6%) Query: 10 EISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELE 69 E S +L + V+ LNRQL+ RD ++ + +K + K + +KDEL+ Sbjct: 146 ETSRSKLEAQEVQ-LNRQLQKE--IRDNSALTQEGMKIVKEHN---ELQEKLMSRKDELQ 199 Query: 70 NEKSQEWHDMELMQDENNRIREEIEAL 96 N +Q ++ + +E+ I E +L Sbjct: 200 NTLNQVLGNLSKLDEEDKEITAEKNSL 226 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 26.6 bits (56), Expect = 5.7 Identities = 14/57 (24%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 36 DQIVRMKQRRRTLKNRGYAASCRIKRIEQKD-ELENEKSQEWHDMELMQDENNRIRE 91 D I++M + + +++ + K++ Q++ ELE+ K Q H ++ + +E N+ +E Sbjct: 220 DSIIQMTEAQTQNEDKINKLEMKNKQLSQQNKELEDTKRQLSHQIQQLINEKNKRKE 276 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 26.6 bits (56), Expect = 5.7 Identities = 21/97 (21%), Positives = 48/97 (49%), Gaps = 6/97 (6%) Query: 13 DDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAA---SCRIKR--IEQKDE 67 ++E ++ V+ N L L + R+++ +T K + Y+ CR + + D+ Sbjct: 71 NNERLANEVKSKNDLLVKVALLETERKRLEEELKT-KEKSYSKIEDKCRSMKDKLGHYDD 129 Query: 68 LENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 LE++ + + + + EN ++EE+E L+ + L+ Sbjct: 130 LEDKVYRYERERKSLTKENKELKEELEDLKISKNELE 166 >SB_44890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 26.6 bits (56), Expect = 5.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 70 NEKSQEWHDMELMQDENNRIREEIEALRSKYDA 102 NEK ++ ++DEN ++ E E L+S DA Sbjct: 122 NEKDDLESEIGKLEDENRALQSEYERLKSMRDA 154 >SB_36565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 26.6 bits (56), Expect = 5.7 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Query: 55 ASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 A+ + R K+ L + E+ D E+ +D +R+R ++++LR D+L+ Sbjct: 241 AAREVARRAFKERLREIQMSEY-DAEMYEDFLSRVRRQVQSLRVILDSLQ 289 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 26.6 bits (56), Expect = 5.7 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Query: 35 RDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIE 94 R+++ R+++ R+ + R A R++ ++ E E ++ +E +E R REE + Sbjct: 1089 REEVRRLEEERKREEERRLAEQRRVEEERRRKEEEEQRRRE--------EEERRRREEED 1140 Query: 95 ALRSK 99 LR + Sbjct: 1141 RLREE 1145 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 26.6 bits (56), Expect = 5.7 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 8/73 (10%) Query: 23 DLNRQLKMRGLTRDQIVRMKQ-RRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMEL 81 D N + +++++ K+ RTL G A + +K Q ELE + L Sbjct: 2342 DRNNLMAENENLKEELLDTKEVLERTLVKLGDAEADLLKLQMQNKELETS-------LNL 2394 Query: 82 MQDENNRIREEIE 94 +Q+EN+RIR E++ Sbjct: 2395 VQEENDRIRPELQ 2407 Score = 26.2 bits (55), Expect = 7.5 Identities = 24/90 (26%), Positives = 47/90 (52%), Gaps = 11/90 (12%) Query: 27 QLKMRGLTRDQIVRMKQ--RRRTLKNRGYAASCRIK-RIEQKDE------LENEKSQ-EW 76 Q + G R+ I + Q + R+ N + +K R+E KD+ EN+K++ E Sbjct: 2746 QNRSEGYRRENIEKQAQIDQMRSKNNMLETENANLKKRLEDKDQDLRNITAENDKNKVEN 2805 Query: 77 HDMELMQ-DENNRIREEIEALRSKYDALKR 105 + ++ + + +REE+ +L+SK D L++ Sbjct: 2806 YKLKTAKFSAEDSLREEVGSLKSKSDDLEK 2835 >SB_21467| Best HMM Match : Peptidase_A17 (HMM E-Value=1.1e-22) Length = 1043 Score = 26.6 bits (56), Expect = 5.7 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 5/79 (6%) Query: 31 RGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIR 90 +GL D + K+R R LK+R AA + K I + + + ++ +E +E Q E R + Sbjct: 48 KGLEYDLEIATKKRNRALKDR--AAKLKHKFIGLQKQQDIKRQRE--TLEREQRELER-K 102 Query: 91 EEIEALRSKYDALKRFATM 109 E+E L + A K ++ Sbjct: 103 GEVEKLEEELTAQKEIQSI 121 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 26.6 bits (56), Expect = 5.7 Identities = 9/38 (23%), Positives = 27/38 (71%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 E+ ++++N+ S+ + ++ +D R+R+EI +L++++ Sbjct: 11 EELNDVQNQYSECYDELVHQEDLMGRLRDEISSLQTEF 48 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 26.6 bits (56), Expect = 5.7 Identities = 14/57 (24%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 36 DQIVRMKQRRRTLKNRGYAASCRIKRIEQKD-ELENEKSQEWHDMELMQDENNRIRE 91 D I++M + + +++ + K++ Q++ ELE+ K Q H ++ + +E N+ +E Sbjct: 220 DSIIQMTEAQTQNEDKINKLEMKNKQLSQQNKELEDTKRQLSHQIQQLINEKNKRKE 276 >SB_6581| Best HMM Match : HEAT (HMM E-Value=3e-05) Length = 1188 Score = 26.6 bits (56), Expect = 5.7 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 8/75 (10%) Query: 15 ELVSISVRDLNRQLKMRGLTRDQIVRMKQRR--RTLKNRGYAASCRIKRIEQKDELENEK 72 E ++ SV D+ ++ + D I+ R RT+ NR + K + L K Sbjct: 856 EQIADSVTDIGHEVLNTSPSTDVIISAIIHRFPRTIVNRSF------KNFNETSLLNELK 909 Query: 73 SQEWHDMELMQDENN 87 ++EW+D+ + D N+ Sbjct: 910 NKEWNDIAPLTDPND 924 >SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) Length = 909 Score = 26.6 bits (56), Expect = 5.7 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 74 QEWHDMELMQDENNRIREEIEALRSKYDAL--KRFATMKSIPLPAEL 118 +E H ++ ENN+I + IE + ++ L ++ M IP+ E+ Sbjct: 291 RELHQADVQYQENNKIMKTIEQAKEQFTILFEEKKTEMGKIPISLEV 337 >SB_59762| Best HMM Match : Vicilin_N (HMM E-Value=4) Length = 206 Score = 26.2 bits (55), Expect = 7.5 Identities = 16/66 (24%), Positives = 29/66 (43%) Query: 40 RMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSK 99 +MK +RR + R A ++R +E NE+ + L +++ R R+ L + Sbjct: 58 KMKAKRRISRKRIITARKHLQRTRGGEEQNNEEERSRRPRVLTEEQRARQRQRDLVLTEE 117 Query: 100 YDALKR 105 KR Sbjct: 118 QRVRKR 123 >SB_50642| Best HMM Match : Spectrin (HMM E-Value=1) Length = 739 Score = 26.2 bits (55), Expect = 7.5 Identities = 17/74 (22%), Positives = 30/74 (40%) Query: 39 VRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRS 98 +R K+ + R A + K + DE + +L + RI EI+ALR Sbjct: 53 IREKEAKLNDACRKAQACLKYKSESKTDEAIRRLEHQLRVQQLKLRDETRIVTEIDALRR 112 Query: 99 KYDALKRFATMKSI 112 + F +K++ Sbjct: 113 SKKMIHEFVALKAV 126 >SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 26.2 bits (55), Expect = 7.5 Identities = 14/61 (22%), Positives = 28/61 (45%) Query: 51 RGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMK 110 + YA + R+++K+ +E QE +E + + ++ EAL K + +K Sbjct: 99 KDYALKAEVLRVKEKETVERLHRQEQLQLERERYATASLTQQKEALSEKLSQITLRQNLK 158 Query: 111 S 111 S Sbjct: 159 S 159 >SB_36254| Best HMM Match : Filament (HMM E-Value=0.21) Length = 589 Score = 26.2 bits (55), Expect = 7.5 Identities = 24/90 (26%), Positives = 47/90 (52%), Gaps = 11/90 (12%) Query: 27 QLKMRGLTRDQIVRMKQ--RRRTLKNRGYAASCRIK-RIEQKDE------LENEKSQ-EW 76 Q + G R+ I + Q + R+ N + +K R+E KD+ EN+K++ E Sbjct: 218 QNRSEGYRRENIEKQAQIDQMRSKNNMLETENANLKKRLEDKDQDLRNITAENDKNKVEN 277 Query: 77 HDMELMQ-DENNRIREEIEALRSKYDALKR 105 + ++ + + +REE+ +L+SK D L++ Sbjct: 278 YKLKTAKFSAEDSLREEVGSLKSKSDDLEK 307 >SB_32194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 26.2 bits (55), Expect = 7.5 Identities = 17/57 (29%), Positives = 22/57 (38%) Query: 61 RIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMKSIPLPAE 117 R LE EK +EW + NR R + LR+ F + LPAE Sbjct: 220 RSHASQRLEKEKKKEWVSCIKKTEVTNRKRSLVSFLRNFATGNPFFPSFFHYELPAE 276 >SB_29556| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 712 Score = 26.2 bits (55), Expect = 7.5 Identities = 18/95 (18%), Positives = 44/95 (46%), Gaps = 6/95 (6%) Query: 22 RDLNRQLKMRGLTRDQIV------RMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQE 75 R NR+L ++ L +++ + R+ ++KN+ A + +DE + +++ Sbjct: 19 RQKNRRLDLKELAIEELQDEEPESKFSLRKFSIKNKQKGAKNSLNACTSRDESKVTRARW 78 Query: 76 WHDMELMQDENNRIREEIEALRSKYDALKRFATMK 110 +L QD ++ + + + D+L + A +K Sbjct: 79 GSSEDLTQDLKRDLQLSLSSDKGSLDSLSKHADIK 113 >SB_27924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 26.2 bits (55), Expect = 7.5 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Query: 23 DLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMEL 81 ++N++L+ + + M +RR L N A +KR+E K EL +EW L Sbjct: 169 EINKKLEEKEAKEKE--EMATQRRDLYNARRAKQAELKRLEWKVEL-TAMQEEWDQNSL 224 >SB_10083| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1457 Score = 26.2 bits (55), Expect = 7.5 Identities = 18/95 (18%), Positives = 44/95 (46%), Gaps = 6/95 (6%) Query: 22 RDLNRQLKMRGLTRDQIV------RMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQE 75 R NR+L ++ L +++ + R+ ++KN+ A + +DE + +++ Sbjct: 276 RQKNRRLDLKELAIEELQDEEPESKFSLRKFSIKNKQKGAKNSLNACTSRDESKVTRARW 335 Query: 76 WHDMELMQDENNRIREEIEALRSKYDALKRFATMK 110 +L QD ++ + + + D+L + A +K Sbjct: 336 GSSEDLTQDLKRDLQLSLSSDKGSLDSLSKHADIK 370 >SB_7100| Best HMM Match : zf-DBF (HMM E-Value=2.6e-09) Length = 242 Score = 26.2 bits (55), Expect = 7.5 Identities = 14/66 (21%), Positives = 31/66 (46%) Query: 33 LTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREE 92 +TR R +Q R+ ++ G A C + + K + S++ + D+ +R+ + Sbjct: 159 VTRSPRQRAEQARKATRSTGKAGYCEVCDVTYKGVTRHLASKKHRQQAMKSDKYSRVDKL 218 Query: 93 IEALRS 98 I + R+ Sbjct: 219 IRSGRT 224 >SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 26.2 bits (55), Expect = 7.5 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 6/64 (9%) Query: 41 MKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKY 100 +K+ R LKN A S E ++ NEK + ++E +++EN ++ EI + Sbjct: 475 LKKDREDLKNECLALS------ETVTKIANEKREMEKEIEKLEEENKKLVSEINDFKVNI 528 Query: 101 DALK 104 L+ Sbjct: 529 QKLE 532 >SB_47589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 26.2 bits (55), Expect = 7.5 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 45 RRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIE 94 +R +G+A K E K ++E EK Q ++ ++E N + +E+E Sbjct: 21 KRKKNKKGHAIPPE-KIAEMKAKIEAEKLQLQEKKDMAEEEKNAVAKELE 69 >SB_46937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 26.2 bits (55), Expect = 7.5 Identities = 16/92 (17%), Positives = 49/92 (53%), Gaps = 3/92 (3%) Query: 13 DDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEK 72 D ++ ++ + +R++ + + R++ +KQ + L++ R++ +++ +EN + Sbjct: 337 DKDIENLQQKLTDREVALSEVRRNE-GSVKQEKENLESDMSTLRSRLRELQEI--IENTE 393 Query: 73 SQEWHDMELMQDENNRIREEIEALRSKYDALK 104 + EL+ + + +E+ ALR++ + L+ Sbjct: 394 KAAQSNTELLTSKLSTRTQEVNALRTENEELR 425 >SB_46461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 817 Score = 26.2 bits (55), Expect = 7.5 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 9/94 (9%) Query: 17 VSISVRDLNRQLK-MRGLTRDQIVRMKQR---RRTLKNRGYAASCRIKRIEQKDELEN-- 70 ++ S+ +NR+++ ++ +DQ R+ + R + +R + SC D EN Sbjct: 98 INNSLNSVNREVEHLKAELQDQDKRLAELASGRERVPHRSESTSCSNLPSTVFDSCENTE 157 Query: 71 EKSQEWHDMELMQDENNRIREEIEALRSKYDALK 104 + + DM + EN R+R+E E L + D K Sbjct: 158 DTGPKLGDMTI---ENQRLRQENEFLSKELDEFK 188 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 26.2 bits (55), Expect = 7.5 Identities = 10/40 (25%), Positives = 25/40 (62%) Query: 66 DELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 D+L +E +Q+ +++ +DE N ++++ L +A++R Sbjct: 97 DQLASENTQKAAELKAKEDEINTLKQDTVRLTKMREAIQR 136 >SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 26.2 bits (55), Expect = 7.5 Identities = 16/62 (25%), Positives = 27/62 (43%) Query: 40 RMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSK 99 R ++RRR K + E++ E NE+ ++ + E +DE EE E K Sbjct: 51 RRRRRRRRRKKEKKKKEEEEEEEEEETEAVNEEEEKIEETEKEKDEEEENEEEEEEEEDK 110 Query: 100 YD 101 + Sbjct: 111 VE 112 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 25.8 bits (54), Expect = 9.9 Identities = 13/54 (24%), Positives = 27/54 (50%) Query: 39 VRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREE 92 + ++++R K R + K +EQ + ++ QE + Q+E +R+ EE Sbjct: 1181 LEVQKKREEKKKREEEMREKEKEMEQNKIDQEKRKQELMESRRFQEEQDRLEEE 1234 >SB_54706| Best HMM Match : Linker_histone (HMM E-Value=0.014) Length = 323 Score = 25.8 bits (54), Expect = 9.9 Identities = 18/109 (16%), Positives = 46/109 (42%) Query: 2 PLSPTPCAEISDDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKR 61 P P + SD + +I ++ L R++ +R + +RR ++ R Sbjct: 60 PAKPAEHPKYSDMVVAAIGALKERNGSSLKSLQRNRQLRNQPQRRPPNSQPRKGDGRGNA 119 Query: 62 IEQKDELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKRFATMK 110 + E ++ SQ+ + MQ+ N++++ +++ ++ + K Sbjct: 120 LMDSTEKQSTNSQKHNTNSQMQNTNSQMQNTNSQMQNTNSQMQNTISQK 168 >SB_54691| Best HMM Match : SWIRM (HMM E-Value=0.0033) Length = 809 Score = 25.8 bits (54), Expect = 9.9 Identities = 16/87 (18%), Positives = 41/87 (47%) Query: 13 DDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEK 72 D+E+V+I + + Q+K+R + + + R +K+ +++ DEL++E Sbjct: 711 DEEIVNIKIELNDVQIKLRETSMELGKTQAKNRSLIKHEQALQGKHDTLLQRVDELDSEC 770 Query: 73 SQEWHDMELMQDENNRIREEIEALRSK 99 + ++ E + +++ +E K Sbjct: 771 EDLRGRLMDVEGERDDLQDSLETAEGK 797 >SB_41162| Best HMM Match : FbpA (HMM E-Value=0.043) Length = 949 Score = 25.8 bits (54), Expect = 9.9 Identities = 21/94 (22%), Positives = 47/94 (50%), Gaps = 3/94 (3%) Query: 10 EISDDELVSISVRDLNRQ--LKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDE 67 +I + +L S+ ++ + Q L+ + L Q R+ + R + + A +++++ + E Sbjct: 624 DIYEAKLSSLMTKESHLQDLLEAKALAVAQADRLISQYRCRRAQSEAECSKLRKLLSETE 683 Query: 68 LENEKSQEWHDMELMQDEN-NRIREEIEALRSKY 100 +NE E + L +EN + I EE + L+ + Sbjct: 684 KKNEAQTEQMETLLRTNENLSIIAEEHKQLKKAF 717 >SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) Length = 1148 Score = 25.8 bits (54), Expect = 9.9 Identities = 16/87 (18%), Positives = 41/87 (47%) Query: 13 DDELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEK 72 D+E+V+I + + Q+K+R + + + R +K+ +++ DEL++E Sbjct: 638 DEEIVNIKIELNDVQIKLRETSMELGKTQAKNRSLIKHEQALQGKHDTLLQRVDELDSEC 697 Query: 73 SQEWHDMELMQDENNRIREEIEALRSK 99 + ++ E + +++ +E K Sbjct: 698 EDLRGRLMDVEGERDDLQDSLETAEGK 724 >SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 25.8 bits (54), Expect = 9.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Query: 84 DENNRIREEIEALRSKYDAL 103 DE +IR E+ A+++K DAL Sbjct: 25 DERRKIRAELRAIKAKKDAL 44 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 25.8 bits (54), Expect = 9.9 Identities = 17/71 (23%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Query: 35 RDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIE 94 RD+ ++M+Q+R+ A KR ++ + E E ++ +++E + EEI Sbjct: 10 RDKFLKMRQKRQEEDKAKKEAEMEKKRRREERQREAEAQKK------LEEERRQQEEEIR 63 Query: 95 ALRSKYDALKR 105 R + + L R Sbjct: 64 RARLQQERLSR 74 >SB_15422| Best HMM Match : TACC (HMM E-Value=6.4e-20) Length = 1362 Score = 25.8 bits (54), Expect = 9.9 Identities = 15/88 (17%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Query: 19 ISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDE--LENEKSQEW 76 + +++++++ + +++ R + RT+ N + +K + +N KS+ Sbjct: 274 MEIQEISKKCQASTDENEKLRRENEELRTVMNEYERTMAEMIENGKKSQTMFDNSKSEVI 333 Query: 77 HDMELMQDENNRIREEIEALRSKYDALK 104 + + +Q + N + L +YD LK Sbjct: 334 KERDQLQADLNSVEAAFSDLHRRYDKLK 361 >SB_58222| Best HMM Match : HS1_rep (HMM E-Value=0) Length = 727 Score = 25.8 bits (54), Expect = 9.9 Identities = 15/53 (28%), Positives = 26/53 (49%) Query: 42 KQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEIE 94 KQRR+ + R A+ R + +E + E + + + +DE R +EE E Sbjct: 394 KQRRQAKEQREREAAQRRQEMEAAKDAEASEREAEAERAAAEDEARRQQEEAE 446 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 25.8 bits (54), Expect = 9.9 Identities = 9/35 (25%), Positives = 24/35 (68%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREEIEALR 97 +Q ++L+N+ + + D+ +++EN++ E I+ L+ Sbjct: 2023 DQNNKLDNDLASQSRDVITLKEENDKANEVIKQLQ 2057 >SB_50076| Best HMM Match : Filament (HMM E-Value=0.15) Length = 380 Score = 25.8 bits (54), Expect = 9.9 Identities = 13/46 (28%), Positives = 27/46 (58%), Gaps = 7/46 (15%) Query: 64 QKDELENEKSQEWHDMELMQDENNRIREEIEA-------LRSKYDA 102 +K+EL N+ + +E + +N + ++EIE+ +++KYDA Sbjct: 131 EKEELHNDYIEMQRKLEELWQDNEKYKKEIESQKKTNQLMKAKYDA 176 >SB_49480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 25.8 bits (54), Expect = 9.9 Identities = 11/52 (21%), Positives = 27/52 (51%) Query: 14 DELVSISVRDLNRQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQK 65 D+L +R+ +RQ R +R+ + ++ L N+ Y + ++++ +K Sbjct: 129 DKLADAQIRETDRQAGRRTNSRNGQLNAPDKQNRLTNKTYYGATKLEKNSEK 180 >SB_48727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 25.8 bits (54), Expect = 9.9 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Query: 26 RQLKMRGLTRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDE 85 R+ K R + + + R + R+R R + K + +DE EK++ ++E M E Sbjct: 16 RKSKKRDVQHNTVCRRQARKREKLARRQSV---FKEVNFRDEEVKEKARRCLEIEYMSSE 72 Query: 86 NNRIRE 91 + I E Sbjct: 73 ESDIDE 78 >SB_46938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 25.8 bits (54), Expect = 9.9 Identities = 11/38 (28%), Positives = 22/38 (57%) Query: 37 QIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQ 74 QI + ++ +NR Y A +R++Q+ +E EK++ Sbjct: 21 QIDKYRREAEDARNRIYEAEQDAQRVQQESVMETEKTK 58 >SB_35619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 25.8 bits (54), Expect = 9.9 Identities = 9/28 (32%), Positives = 18/28 (64%) Query: 77 HDMELMQDENNRIREEIEALRSKYDALK 104 H++ +++D +R E + LR +YD L+ Sbjct: 122 HEVGVLEDREETLRMEYDHLRMEYDHLR 149 >SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 25.8 bits (54), Expect = 9.9 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Query: 34 TRDQIVRMKQRRRTLKNRGYAASCRIKRIEQK-DELENEKSQEWHDMELMQDENNRIREE 92 T+ + ++R +L+ A RI+ +E + DELE +K + ++E + R Sbjct: 284 TKKALKGSEERVSSLEKTVEARESRIRTLECRVDELERQKKKIKEELECVSFNTQAARAS 343 Query: 93 IEALRSKYD 101 L +YD Sbjct: 344 KSQLLREYD 352 >SB_14999| Best HMM Match : E-MAP-115 (HMM E-Value=0.71) Length = 150 Score = 25.8 bits (54), Expect = 9.9 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 6/77 (7%) Query: 27 QLKMRGLTRDQIVRM-KQRRRTLKNRGYAASCRIKRIEQKDELENEKSQ-EWHDMELMQD 84 Q RG T Q+ + K R T+ + + S R + E+ +E +E + E + EL Sbjct: 48 QSDQRGKTLIQLRNLDKGDRETINDPNTSGSRRQEARERNEERLSENDELERENREL--- 104 Query: 85 ENNR-IREEIEALRSKY 100 EN + +RE I+A+ KY Sbjct: 105 ENQKPLRERIKAISKKY 121 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/40 (30%), Positives = 22/40 (55%) Query: 66 DELENEKSQEWHDMELMQDENNRIREEIEALRSKYDALKR 105 DE+ ++ S E +++E +E+++ RS ALKR Sbjct: 1257 DEVSSQLSMSRQRNEKLEEELKDTKEDVQRRRSDMSALKR 1296 >SB_12735| Best HMM Match : PT (HMM E-Value=0.36) Length = 1148 Score = 25.8 bits (54), Expect = 9.9 Identities = 13/37 (35%), Positives = 18/37 (48%) Query: 85 ENNRIREEIEALRSKYDALKRFATMKSIPLPAELDIL 121 E NR R ++E LRS Y + F M + + D L Sbjct: 975 EKNRQRSDVERLRSTYHVSESFLAMDKQGVSLDADQL 1011 >SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) Length = 298 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Query: 63 EQKDELENEKSQEWHDMELMQDENNRIREEIEALRSK 99 + + + E E S +W +E EN R+REE++ L+ + Sbjct: 187 DMRRQKEIEISMKWKQLE---KENARLREELQQLKDR 220 >SB_4328| Best HMM Match : Vicilin_N (HMM E-Value=0.39) Length = 738 Score = 25.8 bits (54), Expect = 9.9 Identities = 14/70 (20%), Positives = 38/70 (54%), Gaps = 4/70 (5%) Query: 34 TRDQIVRMKQRRRTLKNRGYAASCRIKRIEQKDELENEKSQEWHDMELMQDENNRIREEI 93 T Q +R R+RT G+ A R + ++Q+D+++ + ++ +++++ + R +EI Sbjct: 500 TEQQQIRDDIRQRT---EGFTAR-RDELVQQRDDVKEQIAELERQLDVLRSQEMRFTQEI 555 Query: 94 EALRSKYDAL 103 + + + + Sbjct: 556 KEEEERIETI 565 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.132 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,880,950 Number of Sequences: 59808 Number of extensions: 133989 Number of successful extensions: 1215 Number of sequences better than 10.0: 152 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 71 Number of HSP's that attempted gapping in prelim test: 955 Number of HSP's gapped (non-prelim): 332 length of query: 122 length of database: 16,821,457 effective HSP length: 74 effective length of query: 48 effective length of database: 12,395,665 effective search space: 594991920 effective search space used: 594991920 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -