BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000155-TA|BGIBMGA000155-PA|IPR003521|Nucleotide- sensitive chloride conductance regulator (201 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces... 27 1.9 SPAC110.02 |pds5||cohesin-associated protein Pds5|Schizosaccharo... 25 7.7 >SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces pombe|chr 1|||Manual Length = 369 Score = 27.1 bits (57), Expect = 1.9 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 42 NVIWGGGVSPSGNPAPTINLLYPSISLHAIQREPSPALYM-VLNYELRLPELSQQAG 97 N++ SG P+ N L + S+ + ++EPS L++ L++E +L + G Sbjct: 193 NILIKSNTDFSGRPSKPANTLSKTASIQSSKKEPSSILFVGNLDFETTDADLKEHFG 249 >SPAC110.02 |pds5||cohesin-associated protein Pds5|Schizosaccharomyces pombe|chr 1|||Manual Length = 1205 Score = 25.0 bits (52), Expect = 7.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 113 PITQLRFIPENENELQA 129 P T L IP+ ENELQA Sbjct: 272 PTTLLNIIPQFENELQA 288 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.314 0.133 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 737,484 Number of Sequences: 5004 Number of extensions: 25032 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 35 Number of HSP's gapped (non-prelim): 2 length of query: 201 length of database: 2,362,478 effective HSP length: 69 effective length of query: 132 effective length of database: 2,017,202 effective search space: 266270664 effective search space used: 266270664 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -