BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000155-TA|BGIBMGA000155-PA|IPR003521|Nucleotide- sensitive chloride conductance regulator (201 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 27 8.0 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 51 PSGNPAPTINLLYPSISLHAIQREPSPALYMVLNYEL 87 PSG PAP + L PS SL I R+P ++ YE+ Sbjct: 2060 PSGIPAPRVIALSPS-SLLVIIRDPLNPNGVITRYEI 2095 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Query: 17 LQSPSTKLLINDQELGTATLYITENNVIW 45 L + K ++N+ ELGT T YI E W Sbjct: 1441 LTTEQAKQVLNENELGTMTYYIREYTKGW 1469 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.314 0.133 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,333,237 Number of Sequences: 59808 Number of extensions: 175024 Number of successful extensions: 175 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 174 Number of HSP's gapped (non-prelim): 2 length of query: 201 length of database: 16,821,457 effective HSP length: 79 effective length of query: 122 effective length of database: 12,096,625 effective search space: 1475788250 effective search space used: 1475788250 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -