GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000155-TA|BGIBMGA000155-PA|IPR003521|Nucleotide-
sensitive chloride conductance regulator
         (201 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    25   0.65 

>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 24.6 bits (51), Expect = 0.65
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 1   MVVVSSNFAEPADGVLLQSPSTKLL-INDQEL 31
           M++V+S  A  A  ++L+ P TKL  IND  L
Sbjct: 648 MIIVASYTANLAAFLVLERPKTKLTGINDARL 679


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.314    0.133    0.387 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,363
Number of Sequences: 429
Number of extensions: 1627
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 201
length of database: 140,377
effective HSP length: 55
effective length of query: 146
effective length of database: 116,782
effective search space: 17050172
effective search space used: 17050172
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 42 (21.0 bits)