GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000154-TA|BGIBMGA000154-PA|IPR001680|WD-40 repeat,
IPR011046|WD40-like
         (591 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix...    23   4.5  

>AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix
           transcription factor protein.
          Length = 249

 Score = 23.4 bits (48), Expect = 4.5
 Identities = 14/69 (20%), Positives = 32/69 (46%)

Query: 420 PGANPSIEVPMEARLQNLALDVNSKSNVAVNENLTKLLIQGLHSKDKDIILTVLQKNDPR 479
           P A P+    +E       +  N +SN  + E   +  I    ++ K +IL  ++K+  R
Sbjct: 12  PNAIPTTNNQIEMAAATKRVSDNRRSNKPIMEKRRRARINNSLNELKTLILDAMKKDPAR 71

Query: 480 VARVTVSNL 488
            +++  +++
Sbjct: 72  HSKLEKADI 80


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.311    0.128    0.363 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 132,949
Number of Sequences: 317
Number of extensions: 5405
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 591
length of database: 114,650
effective HSP length: 61
effective length of query: 530
effective length of database: 95,313
effective search space: 50515890
effective search space used: 50515890
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 46 (22.6 bits)