BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000149-TA|BGIBMGA000149-PA|IPR000938|CAP-Gly, IPR001611|Leucine-rich repeat (532 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 26 0.57 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 23 4.0 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 26.2 bits (55), Expect = 0.57 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Query: 250 YNRIDEIEXXXXXXXXXXXXXXDGNPITSWSEVMNLGALN-LKVLSLNDCLIAEIRFG 306 YN + + +GNPIT+ S LGA N L+ L+L + + + G Sbjct: 499 YNDLSAVPIVTHSLTELRHLSLEGNPITTLSNTSLLGAANQLEELNLKNIDLTVLESG 556 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 23.4 bits (48), Expect = 4.0 Identities = 14/56 (25%), Positives = 25/56 (44%) Query: 59 LDGIQYFKTSKPSAGSFVRPNKIIPSKTCAEAIRQYYGDPEDETLAAHRRTIINEW 114 LDG+ KT + F + P T + + ++G + ++ H TI+ EW Sbjct: 91 LDGLMLDKTGICVSNVFDFVHFYYPVATMSFYVLNFFGSIQFIIISKHWVTIMKEW 146 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,804 Number of Sequences: 317 Number of extensions: 4949 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 532 length of database: 114,650 effective HSP length: 60 effective length of query: 472 effective length of database: 95,630 effective search space: 45137360 effective search space used: 45137360 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -