BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000145-TA|BGIBMGA000145-PA|undefined (209 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 26 0.19 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 26 0.19 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 26 0.19 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 26 0.19 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 25 0.33 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 3.1 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 21 9.4 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 21 9.4 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 26.2 bits (55), Expect = 0.19 Identities = 18/79 (22%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Query: 75 FAKKTTDADKPKIDETKNTTNEIVS-SADSVLATSAKVKSASFKPTKATGFVPATPPNKK 133 F + + D + P ++E + I+ +A V T+ +V+ PT G + T P K Sbjct: 46 FIRTSEDDNDPHVNEYVESLASIIDEAATKVHGTTVRVRPPKVYPTPYGGRLVWTLPGKT 105 Query: 134 RLGRMSPGPEQLTVKKHQS 152 ++ +++ KK S Sbjct: 106 KMIAHLKDKKKIRAKKRWS 124 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 26.2 bits (55), Expect = 0.19 Identities = 18/79 (22%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Query: 75 FAKKTTDADKPKIDETKNTTNEIVS-SADSVLATSAKVKSASFKPTKATGFVPATPPNKK 133 F + + D + P ++E + I+ +A V T+ +V+ PT G + T P K Sbjct: 360 FIRTSEDDNDPHVNEYVESLASIIDEAATKVHGTTVRVRPPKVYPTPYGGRLVWTLPGKT 419 Query: 134 RLGRMSPGPEQLTVKKHQS 152 ++ +++ KK S Sbjct: 420 KMIAHLKDKKKIRAKKRWS 438 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 26.2 bits (55), Expect = 0.19 Identities = 18/79 (22%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Query: 75 FAKKTTDADKPKIDETKNTTNEIVS-SADSVLATSAKVKSASFKPTKATGFVPATPPNKK 133 F + + D + P ++E + I+ +A V T+ +V+ PT G + T P K Sbjct: 593 FIRTSEDDNDPHVNEYVESLASIIDEAATKVHGTTVRVRPPKVYPTPYGGRLVWTLPGKT 652 Query: 134 RLGRMSPGPEQLTVKKHQS 152 ++ +++ KK S Sbjct: 653 KMIAHLKDKKKIRAKKRWS 671 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 26.2 bits (55), Expect = 0.19 Identities = 18/79 (22%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Query: 75 FAKKTTDADKPKIDETKNTTNEIVS-SADSVLATSAKVKSASFKPTKATGFVPATPPNKK 133 F + + D + P ++E + I+ +A V T+ +V+ PT G + T P K Sbjct: 593 FIRTSEDDNDPHVNEYVESLASIIDEAATKVHGTTVRVRPPKVYPTPYGGRLVWTLPGKT 652 Query: 134 RLGRMSPGPEQLTVKKHQS 152 ++ +++ KK S Sbjct: 653 KMIAHLKDKKKIRAKKRWS 671 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 25.4 bits (53), Expect = 0.33 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Query: 79 TTDADKPKIDETKNTTNEIVSSADSVLATSAKVKSASFKPTKATGFVPATPPNKKRLGRM 138 T+ +D + +T+ ++ S S A+ S P A P TPPN + L + Sbjct: 58 TSGSDFHSSSPSSDTSQDLQHSYQSPQTQPARFYSTPIVPHFAYNHNPLTPPNSEPL--V 115 Query: 139 SPGPEQ 144 SP E+ Sbjct: 116 SPKSEK 121 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.2 bits (45), Expect = 3.1 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 6/49 (12%) Query: 30 AEAVDDLICSFDYMDTAMDNL--VMLV----FIWMVLSIAIIAIAKWAY 72 A D +IC D AM L LV FIW+VLS + A A A+ Sbjct: 465 ANFYDAMICVAYKFDAAMMALRTSFLVNDFGFIWLVLSSTVRAYASRAF 513 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 20.6 bits (41), Expect = 9.4 Identities = 12/47 (25%), Positives = 18/47 (38%) Query: 102 DSVLATSAKVKSASFKPTKATGFVPATPPNKKRLGRMSPGPEQLTVK 148 + V+ AS P + A+P + L PG Q+ VK Sbjct: 146 NKVVTPKTSPNEASMSPQSTSSNNSASPKACQFLYNQFPGSSQVVVK 192 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 20.6 bits (41), Expect = 9.4 Identities = 12/47 (25%), Positives = 18/47 (38%) Query: 102 DSVLATSAKVKSASFKPTKATGFVPATPPNKKRLGRMSPGPEQLTVK 148 + V+ AS P + A+P + L PG Q+ VK Sbjct: 166 NKVVTPKTSPNEASMSPQSTSSNNSASPKACQFLYNQFPGSSQVVVK 212 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.128 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,151 Number of Sequences: 317 Number of extensions: 1890 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 209 length of database: 114,650 effective HSP length: 54 effective length of query: 155 effective length of database: 97,532 effective search space: 15117460 effective search space used: 15117460 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -