GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000143-TA|BGIBMGA000143-PA|IPR011009|Protein
kinase-like, IPR008271|Serine/threonine protein kinase, active site,
IPR000719|Protein kinase, IPR002290|Serine/threonine protein kinase
         (140 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosin...    36   2e-04

>AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosine
           kinase Torso-likeprotein protein.
          Length = 803

 Score = 35.5 bits (78), Expect = 2e-04
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 2/43 (4%)

Query: 32  EIILALEQLHKLGIIYRDIKLENILLDAEGHIV-LTDFGLSKE 73
           ++ L +E L K  +++RD+   N+L+  E H V ++DFGLS++
Sbjct: 600 QVALGMEHLAKTRVVHRDLAARNVLV-CENHTVKVSDFGLSRD 641


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.140    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,698
Number of Sequences: 317
Number of extensions: 1061
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 140
length of database: 114,650
effective HSP length: 51
effective length of query: 89
effective length of database: 98,483
effective search space:  8764987
effective search space used:  8764987
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.9 bits)
S2: 39 (19.8 bits)