BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000141-TA|BGIBMGA000141-PA|undefined (174 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 20 9.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 20 9.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 20 9.8 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.2 bits (40), Expect = 9.8 Identities = 14/53 (26%), Positives = 23/53 (43%) Query: 112 SSSVELIGGTVPAPARDSIDWNLVDASKIRKRCKDRLVLSIYSYENTRLTEIE 164 S + + + T R D L+D S R +D + S E ++TE+E Sbjct: 237 SPNCDKLSSTEQLFIRPMYDAFLIDQSLALNRGRDENPRTYRSDEGPQITELE 289 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.2 bits (40), Expect = 9.8 Identities = 14/53 (26%), Positives = 23/53 (43%) Query: 112 SSSVELIGGTVPAPARDSIDWNLVDASKIRKRCKDRLVLSIYSYENTRLTEIE 164 S + + + T R D L+D S R +D + S E ++TE+E Sbjct: 470 SPNCDKLSSTEQLFIRPMYDAFLIDQSLALNRRRDENPRNYRSDEGPQITELE 522 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.2 bits (40), Expect = 9.8 Identities = 14/53 (26%), Positives = 23/53 (43%) Query: 112 SSSVELIGGTVPAPARDSIDWNLVDASKIRKRCKDRLVLSIYSYENTRLTEIE 164 S + + + T R D L+D S R +D + S E ++TE+E Sbjct: 470 SPNCDKLSSTEQLFIRPMYDAFLIDQSLALNRRRDENPRNYRSDEGPQITELE 522 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.128 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,690 Number of Sequences: 317 Number of extensions: 1070 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 174 length of database: 114,650 effective HSP length: 53 effective length of query: 121 effective length of database: 97,849 effective search space: 11839729 effective search space used: 11839729 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.8 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -