BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000141-TA|BGIBMGA000141-PA|undefined (174 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39653-1|AAM69065.2| 2471|Caenorhabditis elegans Hypothetical pr... 29 2.4 L23650-1|AAA27955.1| 1076|Caenorhabditis elegans Egg laying defe... 27 7.3 >U39653-1|AAM69065.2| 2471|Caenorhabditis elegans Hypothetical protein T13H2.5a protein. Length = 2471 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/35 (37%), Positives = 19/35 (54%) Query: 96 KDIREESAPVAGPSKRSSSVELIGGTVPAPARDSI 130 K I+E G K+ + ELI G +P P+ DS+ Sbjct: 440 KLIKESKKKPCGRPKKKFAPELIEGDIPTPSEDSL 474 >L23650-1|AAA27955.1| 1076|Caenorhabditis elegans Egg laying defective protein 45 protein. Length = 1076 Score = 27.1 bits (57), Expect = 7.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Query: 135 VDASKIRKRCKDRLVLSIYSYENTRLTEIENL 166 +DA K RK ++ + SYE R TEIE + Sbjct: 548 LDAEKRRKEILKKIEGQVTSYEKNRPTEIERI 579 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.310 0.128 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,935,669 Number of Sequences: 27539 Number of extensions: 134747 Number of successful extensions: 281 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 279 Number of HSP's gapped (non-prelim): 2 length of query: 174 length of database: 12,573,161 effective HSP length: 77 effective length of query: 97 effective length of database: 10,452,658 effective search space: 1013907826 effective search space used: 1013907826 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -