BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000141-TA|BGIBMGA000141-PA|undefined (174 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 26 0.23 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 21 5.0 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 25.8 bits (54), Expect = 0.23 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Query: 141 RKRCKDRLVLSIYSYENTRLTEIENLRLNYQYNK 174 R+R K+R ++S S N ++ I N N YNK Sbjct: 73 RERSKERKIIS--SLSNNYISNISNYNNNNNYNK 104 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 21.4 bits (43), Expect = 5.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Query: 135 VDASKIRKRCKDRLVLSIYSYENTRLTEIENLRLNYQYNK 174 +DA+ R+ + VL + +LTE E LN + +K Sbjct: 104 IDATPFRQWYEGHYVLPLGRKRGAKLTEAEEEVLNKKRSK 143 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.310 0.128 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,142 Number of Sequences: 429 Number of extensions: 1728 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 174 length of database: 140,377 effective HSP length: 54 effective length of query: 120 effective length of database: 117,211 effective search space: 14065320 effective search space used: 14065320 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.3 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -