Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000140-TA|BGIBMGA000140-PA|IPR005612|CBF
         (1096 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    27   2.0  

>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
           polyprotein protein.
          Length = 1726

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query: 345 TSDRYY---SALYKKLTNSDILNTTHTALLFSLVYKSLKQDKNIPRVVAFVKRLLQ 397
           T+D YY    AL K+  NS +L   +    +SL        + + R+V    RL++
Sbjct: 184 TADNYYVTWEALLKRYDNSKVLKREYFKAFYSLEKMKTDSTEELARIVNEANRLVR 239


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.314    0.131    0.371 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 974,198
Number of Sequences: 2123
Number of extensions: 37591
Number of successful extensions: 47
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 47
Number of HSP's gapped (non-prelim): 1
length of query: 1096
length of database: 516,269
effective HSP length: 71
effective length of query: 1025
effective length of database: 365,536
effective search space: 374674400
effective search space used: 374674400
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 53 (25.4 bits)