BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000140-TA|BGIBMGA000140-PA|IPR005612|CBF (1096 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 27 0.70 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 24 6.5 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 27.1 bits (57), Expect = 0.70 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Query: 790 FSGDEDGKDDLSSLFASAEEFSTLLEDTAANKKQG----SSQAVSNTDNS 835 F + DG+D+ S EE S+L++ T + +K G S++ VS D+S Sbjct: 21 FKDEGDGEDEKRSSENLTEEKSSLIDLTESEEKSGGSYSSNKNVSRADHS 70 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.8 bits (49), Expect = 6.5 Identities = 8/30 (26%), Positives = 18/30 (60%) Query: 50 WFHQLPEEPVTLPKTLSTEQIEQLRKEATS 79 W +++P PV++ E++ L +++TS Sbjct: 321 WLNEIPTMPVSIKDQTIKEELALLAQQSTS 350 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.131 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,172 Number of Sequences: 317 Number of extensions: 8964 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 1096 length of database: 114,650 effective HSP length: 64 effective length of query: 1032 effective length of database: 94,362 effective search space: 97381584 effective search space used: 97381584 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -