BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000140-TA|BGIBMGA000140-PA|IPR005612|CBF (1096 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 26 1.9 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 25 3.4 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 24 7.8 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 25.8 bits (54), Expect = 1.9 Identities = 12/44 (27%), Positives = 23/44 (52%) Query: 927 IGENVTVSERVTSVDTARSSVDTPSVLPDFNIPTPMNTPVNEIT 970 IGE +TVS T +S+ + +++ + T + P N+I+ Sbjct: 421 IGEVITVSFTATLASIGAASIPSAALITMLIVLTALGLPTNDIS 464 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 25.0 bits (52), Expect = 3.4 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 4/63 (6%) Query: 963 NTPVNEITPEILLPISETPKIPTETIRKAATLLKLSIVKKDEDDVFVKPSPMTDGMSPAR 1022 N +I P+IL I +TP I I K+ +K I K E F+ P R Sbjct: 29 NGDYTKIMPDILTAIGQTPLIKLNNIPKSYG-IKCEIYAKCE---FLNPGGSVKDRIAYR 84 Query: 1023 MLQ 1025 M+Q Sbjct: 85 MIQ 87 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.8 bits (49), Expect = 7.8 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 550 INMDKVASAYNPLGRSPQHAGAELS 574 +N + ++ +P G SPQH+G+ S Sbjct: 53 VNYAQQHNSPSPTGSSPQHSGSSAS 77 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.314 0.131 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 278,412 Number of Sequences: 429 Number of extensions: 11985 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 3 length of query: 1096 length of database: 140,377 effective HSP length: 65 effective length of query: 1031 effective length of database: 112,492 effective search space: 115979252 effective search space used: 115979252 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -