BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000139-TA|BGIBMGA000139-PA|IPR001245|Tyrosine protein kinase, IPR011009|Protein kinase-like, IPR000719|Protein kinase (166 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 68 5e-14 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 67.7 bits (158), Expect = 5e-14 Identities = 30/99 (30%), Positives = 55/99 (55%), Gaps = 1/99 (1%) Query: 50 IPLRWCPLEVVLEGDYSTKSDVYMYAATVWEMYTQAELPFAKLNDSSVLDRLKTGALEWS 109 +P+RW LE + Y+T SDV+ + +WE+ T P+ ++ S +LD LK+G + Sbjct: 656 LPVRWMALESLTHQRYTTYSDVWSFGVLLWEIVTLGGTPYVGVHSSELLDFLKSGN-RLA 714 Query: 110 VPASMPQSVADILKRCWSQSPTDRPQFAEVCEEINIVLQ 148 PA+ + ++ CW + P +RP F E+ + + +L+ Sbjct: 715 RPANCSPDLYAVMLNCWKECPKNRPTFTELSKSLEGLLE 753 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.129 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,109 Number of Sequences: 317 Number of extensions: 1404 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 166 length of database: 114,650 effective HSP length: 52 effective length of query: 114 effective length of database: 98,166 effective search space: 11190924 effective search space used: 11190924 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -