BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000138-TA|BGIBMGA000138-PA|IPR002773|Deoxyhypusine synthase (371 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 25 0.66 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 23 2.7 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 25.4 bits (53), Expect = 0.66 Identities = 14/68 (20%), Positives = 29/68 (42%) Query: 7 VEKPVKVAPNIAVNAVLQPSQDLPAETPIVAGYDWENGTDYNKILESYANSGFQATNFGK 66 VE + ++ + +++ + + P+VA EN T N I ++ FQ + K Sbjct: 171 VESTSNLQADMPLERIIEAEKRVECNDPLVALVVNENNTTVNNICQATHKQLFQLVQWAK 230 Query: 67 TVVEINNM 74 V ++ Sbjct: 231 LVPHFTSL 238 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 23.4 bits (48), Expect = 2.7 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Query: 35 IVAGYDWENGTDYNKILESYANSGFQATNFGKTVVEINNMLK 76 I++G + T + +IL NSG+ T FG + N+ ++ Sbjct: 237 IISGSIFMTTTSFYRIL----NSGYNLTTFGSFIFNANSAIE 274 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.133 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,916 Number of Sequences: 317 Number of extensions: 3515 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 371 length of database: 114,650 effective HSP length: 58 effective length of query: 313 effective length of database: 96,264 effective search space: 30130632 effective search space used: 30130632 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -