GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000138-TA|BGIBMGA000138-PA|IPR002773|Deoxyhypusine
synthase
         (371 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146740-1|AAO12100.1|  139|Anopheles gambiae odorant-binding pr...    24   5.9  

>AY146740-1|AAO12100.1|  139|Anopheles gambiae odorant-binding
           protein AgamOBP9 protein.
          Length = 139

 Score = 24.2 bits (50), Expect = 5.9
 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 183 LFEEWVTPLLDEMISEQMKEGTVWSPSRITARLGERINNESSVCYWAWR 231
           LF++   P++D ++  Q+  G   +  R         N + +VC+WA+R
Sbjct: 72  LFDDTNGPIVDNLVV-QLAHGRDANEVREEIVKCAGSNTDGNVCHWAFR 119


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.133    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 372,538
Number of Sequences: 2123
Number of extensions: 14845
Number of successful extensions: 17
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 17
Number of HSP's gapped (non-prelim): 1
length of query: 371
length of database: 516,269
effective HSP length: 65
effective length of query: 306
effective length of database: 378,274
effective search space: 115751844
effective search space used: 115751844
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 49 (23.8 bits)