BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000138-TA|BGIBMGA000138-PA|IPR002773|Deoxyhypusine
synthase
(371 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding pr... 24 5.9
>AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding
protein AgamOBP9 protein.
Length = 139
Score = 24.2 bits (50), Expect = 5.9
Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Query: 183 LFEEWVTPLLDEMISEQMKEGTVWSPSRITARLGERINNESSVCYWAWR 231
LF++ P++D ++ Q+ G + R N + +VC+WA+R
Sbjct: 72 LFDDTNGPIVDNLVV-QLAHGRDANEVREEIVKCAGSNTDGNVCHWAFR 119
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.317 0.133 0.403
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 372,538
Number of Sequences: 2123
Number of extensions: 14845
Number of successful extensions: 17
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 17
Number of HSP's gapped (non-prelim): 1
length of query: 371
length of database: 516,269
effective HSP length: 65
effective length of query: 306
effective length of database: 378,274
effective search space: 115751844
effective search space used: 115751844
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 49 (23.8 bits)
- SilkBase 1999-2023 -