GeneModel BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000137-TA|BGIBMGA000137-PA|IPR001772|Kinase-associated,
C-terminal
         (313 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g50080.1 68416.m05475 F-box family protein (FBL16) contains s...    28   7.0  

>At3g50080.1 68416.m05475 F-box family protein (FBL16) contains
           similarity to SKP1 interacting partner 2 GI:10716949
           from [Arabidopsis thaliana]; contains Pfam profile:
           PF00646 F-box domain
          Length = 522

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 132 IEVCKLPR-LSLNGVRFKRISGQNKHRLQEHCVKDSE 167
           +E CKL R L ++G R KRI  Q    + +HC+   E
Sbjct: 303 VERCKLLRKLHIDGWRVKRIGDQGLMSVAKHCLNLQE 339


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.320    0.134    0.413 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,771,964
Number of Sequences: 28952
Number of extensions: 197768
Number of successful extensions: 490
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 489
Number of HSP's gapped (non-prelim): 2
length of query: 313
length of database: 12,070,560
effective HSP length: 81
effective length of query: 232
effective length of database: 9,725,448
effective search space: 2256303936
effective search space used: 2256303936
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 59 (27.9 bits)