BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000134-TA|BGIBMGA000134-PA|undefined (165 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0355 + 3912019-3913046,3914354-3914678 32 0.20 08_02_0197 - 14150787-14151440 31 0.46 02_02_0011 + 6083431-6085541,6086659-6086779,6087188-6087247,608... 30 0.81 10_08_1022 + 22337332-22339398 30 1.1 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 30 1.1 07_03_1691 - 28726307-28726323,28726588-28726953,28727483-287275... 29 2.5 06_03_0705 - 23707987-23708295,23708532-23708573,23709772-237099... 28 3.3 09_04_0736 - 19815427-19815642,19815782-19816903,19817006-198177... 28 4.3 03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 28 4.3 12_02_1007 - 25248653-25249078,25249956-25250021,25250108-252502... 27 5.7 12_01_0779 + 7129879-7130398,7130585-7130664 27 5.7 08_01_0118 + 947394-947885,948709-948810,948914-949219,949557-94... 27 5.7 02_04_0452 + 23044190-23045227 27 5.7 02_04_0285 - 21585048-21585173,21585302-21585355,21585512-21585952 27 5.7 05_07_0122 + 27843139-27843792 27 7.5 05_01_0069 - 477394-477656,477921-478041 27 7.5 04_04_1668 + 35217254-35218531 27 7.5 04_01_0083 + 904473-905167,905247-905347,905902-905994,907322-90... 27 7.5 03_05_1142 - 30703333-30703469,30704058-30704205,30704893-307049... 27 7.5 03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 27 7.5 02_05_0337 - 28060009-28060716,28061055-28061498,28061732-280617... 27 7.5 01_06_1043 + 34078015-34079541 27 7.5 01_01_0022 - 170045-170095,170406-170554,170764-170875,171398-17... 27 7.5 12_01_0904 + 8791474-8792261,8792935-8793037,8794009-8794055,879... 27 10.0 11_02_0037 - 7613632-7613727,7614452-7615507 27 10.0 10_06_0036 - 9914606-9915561,9916287-9916368 27 10.0 08_02_0233 + 14593639-14594468,14594480-14594986,14595362-145958... 27 10.0 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 27 10.0 07_01_0303 - 2171796-2172611,2173133-2174062,2174659-2175132,217... 27 10.0 05_03_0468 + 14376926-14377183,14377534-14377710,14377802-143778... 27 10.0 02_01_0035 - 220036-221419,222050-222801 27 10.0 01_01_1067 + 8403584-8404195,8404532-8404693,8404837-8405346,840... 27 10.0 01_01_0052 - 391398-391691,392243-392647 27 10.0 >10_01_0355 + 3912019-3913046,3914354-3914678 Length = 450 Score = 32.3 bits (70), Expect = 0.20 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 100 PVTDEQXXXXXXXXXXXSADKRVMVTIVDGLPVVVTGQNQIPQPPPPVTHHRHAHRDKS 158 PV D + R +TI D + V G + P PPPPVT HR A + S Sbjct: 169 PVVDLVAENMYHAGKVFVCNDRGHLTIFDAATLAVLG-DAAPPPPPPVTLHRDAFKCSS 226 >08_02_0197 - 14150787-14151440 Length = 217 Score = 31.1 bits (67), Expect = 0.46 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 133 VVTGQNQIPQPPPPVTHHRHAHR 155 ++ +N PPPP HH HAH+ Sbjct: 16 MMLSKNPRTPPPPPAMHHHHAHK 38 >02_02_0011 + 6083431-6085541,6086659-6086779,6087188-6087247, 6087354-6088391,6089733-6089925,6090326-6090375, 6090470-6090744,6091114-6091180,6091189-6091278, 6091301-6091381,6091435-6091593 Length = 1414 Score = 30.3 bits (65), Expect = 0.81 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Query: 130 LPVVVTGQNQIPQPPPPVT----HHRHAHRDKSRRLNY 163 LPV T Q +P PPPP + HH + H+ + ++ Y Sbjct: 986 LPVPPTPQQPLPPPPPPPSLQQLHHPYQHQQQQQQQLY 1023 >10_08_1022 + 22337332-22339398 Length = 688 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/28 (39%), Positives = 13/28 (46%) Query: 130 LPVVVTGQNQIPQPPPPVTHHRHAHRDK 157 LP G P PPPP HH H + + Sbjct: 10 LPAFPWGAASTPPPPPPPPHHHHQQQQQ 37 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 29.9 bits (64), Expect = 1.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 143 PPPPVTHHRHAHRDKSR 159 PPPP HH H HR + R Sbjct: 36 PPPPPPHHHHHHRRRHR 52 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Query: 141 PQPPPPVTHHRHAHRDK 157 P PPPP HH H R + Sbjct: 36 PPPPPPHHHHHHRRRHR 52 >07_03_1691 - 28726307-28726323,28726588-28726953,28727483-28727567, 28728255-28728387,28729793-28730328 Length = 378 Score = 28.7 bits (61), Expect = 2.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Query: 136 GQNQIPQPPPPVTHHRHAHRDKSRR 160 G P PPPP HHR A + + R Sbjct: 39 GAGPTPPPPPPPPHHRRARSEVAFR 63 >06_03_0705 - 23707987-23708295,23708532-23708573,23709772-23709957, 23710112-23710222,23710337-23710408,23710499-23710747, 23711052-23711135,23711271-23711456,23711540-23711764 Length = 487 Score = 28.3 bits (60), Expect = 3.3 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 7/86 (8%) Query: 12 VDAAYAVKSLSNVILPGMGHSVSVQRHHAHS---QSYKHKQELP-PPVSKPDAIKSHVMR 67 +D + K LSN L G VQ AHS + +E+ S+P+ +K R Sbjct: 16 IDNGASRKLLSNESLEERGEEHDVQADGAHSGESEVINPAEEVGGEATSQPEDVKP---R 72 Query: 68 LLKRSKSHTPATRALENQPDPRNFER 93 + K S+SH+P + PR+ ++ Sbjct: 73 VSKGSQSHSPKVTTKSQRQSPRSGDK 98 >09_04_0736 - 19815427-19815642,19815782-19816903,19817006-19817707, 19817808-19817855,19817959-19818201,19819035-19819391 Length = 895 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/75 (25%), Positives = 27/75 (36%), Gaps = 4/75 (5%) Query: 19 KSLSNVILPGMGHSVSVQRHHAHSQSYKHKQ--ELPPPVSKPDAIKSHVMRLLKRSKSHT 76 K V LP G+ Q H +Y + LPPP P S +L H+ Sbjct: 733 KQAGAVHLPNYGNLAGAQEHPTQHSAYNPEMTLNLPPPPPPPTLPPSSA--ILSSQVGHS 790 Query: 77 PATRALENQPDPRNF 91 T+ + Q P + Sbjct: 791 LPTQMSQQQYQPEQY 805 >03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 Length = 356 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Query: 117 SADKRVMVTIVDGLPVVVTGQNQIPQPPPPVTHHRHAHR 155 S++KRV T+ DG GQ I P P +++R H+ Sbjct: 123 SSNKRVAATLEDGHVWRKYGQKDIQNSPYPRSYYRCTHK 161 >12_02_1007 - 25248653-25249078,25249956-25250021,25250108-25250260, 25250961-25251336,25252001-25252143 Length = 387 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 136 GQNQIPQPPPPVTHHR 151 G + QPPPPV++HR Sbjct: 65 GASSFDQPPPPVSYHR 80 Score = 26.6 bits (56), Expect = 10.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Query: 41 HSQSYKHKQELPPPVSKP 58 H QSY H PPPV+ P Sbjct: 286 HPQSYMHPPPPPPPVTMP 303 >12_01_0779 + 7129879-7130398,7130585-7130664 Length = 199 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Query: 143 PPPPVTHHRHAHRDKSRRLNYLE 165 PPPP HRH HR +RR + +E Sbjct: 21 PPPPRRRHRH-HRRAARRTHPVE 42 >08_01_0118 + 947394-947885,948709-948810,948914-949219,949557-949616 Length = 319 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 141 PQPPPPVTHHRHAHRDK 157 P PPPP+ H H HR + Sbjct: 29 PSPPPPLHLHLHLHRHR 45 >02_04_0452 + 23044190-23045227 Length = 345 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/35 (34%), Positives = 15/35 (42%) Query: 24 VILPGMGHSVSVQRHHAHSQSYKHKQELPPPVSKP 58 ++L GH H+HS S H PP S P Sbjct: 169 LLLHHAGHGHGHAHSHSHSHSRAHNPSTRPPTSAP 203 >02_04_0285 - 21585048-21585173,21585302-21585355,21585512-21585952 Length = 206 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 141 PQPPPPVTHHRHAHRDKS 158 P+PPPP+ HRH S Sbjct: 29 PRPPPPLRRHRHLSSSSS 46 >05_07_0122 + 27843139-27843792 Length = 217 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/35 (40%), Positives = 20/35 (57%) Query: 46 KHKQELPPPVSKPDAIKSHVMRLLKRSKSHTPATR 80 K K +PP ++ A++ +VMRL KS ATR Sbjct: 70 KIKPPIPPLAARRRALEGNVMRLQAIPKSEPDATR 104 >05_01_0069 - 477394-477656,477921-478041 Length = 127 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/37 (29%), Positives = 16/37 (43%) Query: 52 PPPVSKPDAIKSHVMRLLKRSKSHTPATRALENQPDP 88 PPP A+ +H+ L+ H P L +P P Sbjct: 44 PPPTIHGAAVNTHLQLHLRGRPMHPPPAPQLRREPSP 80 >04_04_1668 + 35217254-35218531 Length = 425 Score = 27.1 bits (57), Expect = 7.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Query: 143 PPPPVTHHRHAH 154 PPPP HH H+H Sbjct: 29 PPPPPDHHSHSH 40 >04_01_0083 + 904473-905167,905247-905347,905902-905994,907322-907968 Length = 511 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 36 QRHHAHSQSYKHKQELPPPVSKP 58 +RHH H K K++ PPP P Sbjct: 28 RRHHHHHNHTKRKKKPPPPPLSP 50 >03_05_1142 - 30703333-30703469,30704058-30704205,30704893-30704963, 30705189-30705285,30705371-30705562,30705639-30705977 Length = 327 Score = 27.1 bits (57), Expect = 7.5 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 8/91 (8%) Query: 3 EVSCVAGNKVDAAYAVKSLSNVILPGMGHSVSVQRHHAHSQSYKHKQELPPP-VSKPDAI 61 ++ +A K AA K N ++ MG S ++++ + LPPP V PDA Sbjct: 20 DLDAIAAIKESAAAEYKEKGNRLVK-MGRSHYADAVDCYTKAIAQMEPLPPPPVPSPDAS 78 Query: 62 -----KSHVMRLL-KRSKSHTPATRALENQP 86 ++HV LL ++ A RA++ P Sbjct: 79 VLFANRAHVNLLLGNHRRALDDAARAVQLSP 109 >03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 Length = 430 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Query: 27 PGMGHSVSVQRHHAHSQ--SYKHKQELPPPVSKPDAIKSH 64 PG S + H H Q + H+ PPP P++ SH Sbjct: 13 PGHRRRGSAAQGHGHHQVHGHHHQPSSPPPPPPPESSPSH 52 >02_05_0337 - 28060009-28060716,28061055-28061498,28061732-28061793, 28061896-28062007,28062144-28062263 Length = 481 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 50 ELPPPVSKPDAIKSHVMRLLKRSKSHTPATRALENQP 86 ++PPP K + ++ +K H PA R LE P Sbjct: 123 QIPPPRPKRKPAHPYPRKVDGAAKKHVPALRQLEKPP 159 >01_06_1043 + 34078015-34079541 Length = 508 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 39 HAHS-QSYKHKQELPPPVSKPDAIKSHVMRLLKRSKSHTPATRAL 82 HAH +SY LP D + ++KRS +HT + +AL Sbjct: 34 HAHGLKSYPVVGTLPHFAKNKDRFLEFITEIMKRSPTHTLSFKAL 78 >01_01_0022 - 170045-170095,170406-170554,170764-170875, 171398-171469,171578-171671,171770-171921,172004-172072 Length = 232 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/41 (34%), Positives = 19/41 (46%) Query: 45 YKHKQELPPPVSKPDAIKSHVMRLLKRSKSHTPATRALENQ 85 YK + P DAIK+ +RLLK + + L NQ Sbjct: 45 YKEQIRKTRPGPSQDAIKARAIRLLKHKRMYEEQRNMLYNQ 85 >12_01_0904 + 8791474-8792261,8792935-8793037,8794009-8794055, 8795180-8795717 Length = 491 Score = 26.6 bits (56), Expect = 10.0 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Query: 58 PDAIKSHVMRLLKRSKSHTPATRALENQPDPRNFERRTVFARPVTD 103 PD + S +RL + H+ A A N P P RR F +P D Sbjct: 72 PDPLSSLHLRLFLPNPHHSAAPAAAANAPPPL---RRNSFPQPAHD 114 >11_02_0037 - 7613632-7613727,7614452-7615507 Length = 383 Score = 26.6 bits (56), Expect = 10.0 Identities = 10/25 (40%), Positives = 12/25 (48%) Query: 140 IPQPPPPVTHHRHAHRDKSRRLNYL 164 +P PPPP H H H LN + Sbjct: 251 LPPPPPPPPHGHHHHHQIIMPLNMI 275 >10_06_0036 - 9914606-9915561,9916287-9916368 Length = 345 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/35 (31%), Positives = 21/35 (60%) Query: 22 SNVILPGMGHSVSVQRHHAHSQSYKHKQELPPPVS 56 ++++LP +G +VS Q H + + H Q+ P P + Sbjct: 17 NSLLLPSLGLAVSGQEAHEVAMAGLHDQQPPSPAA 51 >08_02_0233 + 14593639-14594468,14594480-14594986,14595362-14595856, 14596592-14596662,14597116-14597199,14597328-14597446, 14598029-14598109,14598397-14598411 Length = 733 Score = 26.6 bits (56), Expect = 10.0 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Query: 34 SVQRHHAHSQSYKHKQELPPPVSKPDAIKSHVMRLLKRSKSHT----PATRALEN 84 S Q H H+ K +Q P + DA K+ ++RL + T PA + ++N Sbjct: 622 SSQYIHEHNALNKARQGFPVELGGVDASKTKILRLAHSTPQETWNLVPAAQGIQN 676 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 30 GHSVSVQRHHAHSQSY-KHKQEL 51 GH + HH+HS S+ KH EL Sbjct: 40 GHHTTSNNHHSHSHSHRKHHAEL 62 >07_01_0303 - 2171796-2172611,2173133-2174062,2174659-2175132, 2175569-2175609,2176298-2176337 Length = 766 Score = 26.6 bits (56), Expect = 10.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 130 LPVVVTGQNQIPQPPPP 146 LPV+ GQ P PPPP Sbjct: 560 LPVIPNGQPGAPAPPPP 576 >05_03_0468 + 14376926-14377183,14377534-14377710,14377802-14377867, 14378009-14378134,14378499-14378678,14379015-14379179, 14380185-14380538 Length = 441 Score = 26.6 bits (56), Expect = 10.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 139 QIPQPPPPVTHHRHAH 154 Q PQ PP + HH H H Sbjct: 8 QPPQTPPSLDHHHHHH 23 >02_01_0035 - 220036-221419,222050-222801 Length = 711 Score = 26.6 bits (56), Expect = 10.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Query: 30 GHSVSVQRHHAHSQSYKHKQELPPP 54 GH +Q H KH+Q+ PPP Sbjct: 103 GHHPHLQLFHEQHHHQKHQQQPPPP 127 >01_01_1067 + 8403584-8404195,8404532-8404693,8404837-8405346, 8405434-8405493,8405721-8406137,8406576-8407100 Length = 761 Score = 26.6 bits (56), Expect = 10.0 Identities = 10/19 (52%), Positives = 11/19 (57%) Query: 141 PQPPPPVTHHRHAHRDKSR 159 PQPPPP RH + SR Sbjct: 18 PQPPPPPVAQRHHQQQPSR 36 >01_01_0052 - 391398-391691,392243-392647 Length = 232 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Query: 137 QNQIPQPPPPVTHHRHAHRDKSRRLNYL 164 Q+ IP PP P+ HH H H + + + L Sbjct: 189 QSYIP-PPHPLHHHHHQHHNHHHQQSLL 215 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.130 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,353,564 Number of Sequences: 37544 Number of extensions: 209995 Number of successful extensions: 1234 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 1183 Number of HSP's gapped (non-prelim): 51 length of query: 165 length of database: 14,793,348 effective HSP length: 77 effective length of query: 88 effective length of database: 11,902,460 effective search space: 1047416480 effective search space used: 1047416480 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -