BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000132-TA|BGIBMGA000132-PA|IPR000322|Glycoside
hydrolase, family 31
(849 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 25 1.9
>AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase
protein.
Length = 580
Score = 25.4 bits (53), Expect = 1.9
Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
Query: 304 DVRSVDENFD-VHDIPMDSIWLDIEYTNKKMYFTWDVVKF 342
D+ + D + DI D++WL Y + ++ F +D+ F
Sbjct: 50 DLNGITARMDHIADIGADALWLSPIYKSPQVDFGYDISNF 89
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.319 0.137 0.428
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 275,630
Number of Sequences: 429
Number of extensions: 13631
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 1
length of query: 849
length of database: 140,377
effective HSP length: 64
effective length of query: 785
effective length of database: 112,921
effective search space: 88642985
effective search space used: 88642985
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 48 (23.4 bits)
- SilkBase 1999-2023 -