GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000132-TA|BGIBMGA000132-PA|IPR000322|Glycoside
hydrolase, family 31
         (849 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    25   1.9  

>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 25.4 bits (53), Expect = 1.9
 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 304 DVRSVDENFD-VHDIPMDSIWLDIEYTNKKMYFTWDVVKF 342
           D+  +    D + DI  D++WL   Y + ++ F +D+  F
Sbjct: 50  DLNGITARMDHIADIGADALWLSPIYKSPQVDFGYDISNF 89


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.137    0.428 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 275,630
Number of Sequences: 429
Number of extensions: 13631
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 1
length of query: 849
length of database: 140,377
effective HSP length: 64
effective length of query: 785
effective length of database: 112,921
effective search space: 88642985
effective search space used: 88642985
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 48 (23.4 bits)