BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000131-TA|BGIBMGA000131-PA|IPR009080|Aminoacyl-tRNA synthetase, class 1a, anticodon-binding, IPR010978|tRNA-binding arm, IPR001412|Aminoacyl-tRNA synthetase, class I, IPR002303|Valyl-tRNA synthetase, class Ia, IPR002300|Aminoacyl-tRNA synthetase, class Ia, IPR013155|tRNA synthetase, valyl/leucyl, anticodon-binding (989 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 26 1.1 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 24 5.9 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 23 7.8 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 26.2 bits (55), Expect = 1.1 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 6/56 (10%) Query: 739 IRTLIYNEFCDIYLEASKPGFENDNVRIGYAHAHTLSAVLNTSLRCLYPFMVYITQ 794 I+ +Y E DI+ ++ +P ND +++ Y L VL +LR +YP + IT+ Sbjct: 18 IQEKVYQELRDIFQDSDRPITFNDTLQMKY-----LERVLLETLR-MYPPVPIITR 67 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/40 (22%), Positives = 19/40 (47%) Query: 290 KRVIHPFRTNETIPIIFDKFVDREFGTGAVKITPAHSKVD 329 +R+ P +T +++ + D+ V ++ P H K D Sbjct: 34 RRLRRPLKTTQSVSVTKDQDVSSSVNRFRLRSRPGHRKTD 73 Score = 23.8 bits (49), Expect = 5.9 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Query: 898 NGKD-DKTYVKGILDLNTEIYVELVGDDIENAITNAKNKLEKRIKKLEDSLNNMEEKYSN 956 N KD D + G ++ + E +E ++ ++ N++ K KKL + + +K Sbjct: 463 NAKDVDWQKIAGAVEEDDEDAIEKPAP-VKISVQEVLNRVRKPTKKLHLKNSPISKKVRP 521 Query: 957 SNYLTTIPEWTQVR 970 L I W+Q R Sbjct: 522 PQVLCYITSWSQKR 535 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 23.4 bits (48), Expect = 7.8 Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 832 NEIIEEQAEKILNAVNLIRE 851 +EI EE E +++ +NLI+E Sbjct: 19 SEISEETCETLMSDINLIKE 38 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 240,524 Number of Sequences: 317 Number of extensions: 10766 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 27 Number of HSP's gapped (non-prelim): 4 length of query: 989 length of database: 114,650 effective HSP length: 63 effective length of query: 926 effective length of database: 94,679 effective search space: 87672754 effective search space used: 87672754 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -