BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000128-TA|BGIBMGA000128-PA|undefined (1364 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 34 0.76 At2g46520.1 68415.m05798 cellular apoptosis susceptibility prote... 34 0.76 At2g39300.1 68415.m04825 expressed protein ; expression supporte... 33 1.3 At1g01960.1 68414.m00114 guanine nucleotide exchange family prot... 33 1.3 At1g15660.1 68414.m01880 expressed protein similar to CENPCA pro... 32 2.3 At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transfera... 32 3.0 At5g50140.1 68418.m06210 ankyrin repeat family protein contains ... 31 4.0 At3g25430.1 68416.m03162 CAF1 family ribonuclease contains Pfam ... 31 4.0 At5g52450.1 68418.m06508 MATE efflux protein-related strong simi... 31 5.3 At4g19900.1 68417.m02916 glycosyl transferase-related contains P... 31 5.3 At3g22220.1 68416.m02803 hAT dimerisation domain-containing prot... 31 7.0 At5g50840.1 68418.m06298 expressed protein 30 9.3 At5g28350.2 68418.m03443 expressed protein 30 9.3 At5g28350.1 68418.m03442 expressed protein 30 9.3 At5g10100.1 68418.m01170 trehalose-6-phosphate phosphatase, puta... 30 9.3 At3g61480.1 68416.m06885 expressed protein 30 9.3 At3g29410.1 68416.m03695 terpene synthase/cyclase family protein... 30 9.3 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 33.9 bits (74), Expect = 0.76 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 5/109 (4%) Query: 970 KPDEANEMECVLKGLEFFVETSIRTIEEATSESQQIESSLGLLNVMLRHIKKLDTHEMFK 1029 K DE E+ ++ LE + +E+A S +Q +E L + R++ ++DT + K Sbjct: 2072 KKDETKEIMVHVEALEKTLALKTFELEDAVSHAQMLEVRLQESKEITRNL-EVDTEKARK 2130 Query: 1030 EKDKLFSGIWRSLKTRLSIVFSGKASASCLDDGLATLRSVCESMSVECF 1078 ++KL S + ++ + + K S L++ + + V ESM +E F Sbjct: 2131 CQEKL-SAENKDIRAEAEDLLAEKCS---LEEEMIQTKKVSESMEMELF 2175 >At2g46520.1 68415.m05798 cellular apoptosis susceptibility protein, putative / importin-alpha re-exporter, putative similar to cellular apoptosis susceptibility protein [Homo sapiens] GI:3598795, SP|Q9ERK4 Importin-alpha re-exporter (Chromosome segregation 1-like protein) (Cellular apoptosis susceptibility protein) {Mus musculus}; contains Pfam profiles PF03810: Importin-beta N-terminal domain, PF03378: CAS/CSE protein C-terminus Length = 972 Score = 33.9 bits (74), Expect = 0.76 Identities = 28/131 (21%), Positives = 54/131 (41%), Gaps = 4/131 (3%) Query: 1033 KLFSGIWRSLKTRLSIVFSGKASASCLDDGLATLRSVCESMSVECFVANVAEELMNLSLL 1092 +LF + R LK ++V S +ASC++ L +++ L+ L Sbjct: 506 QLFPELVRFLKAESNVVHS--YAASCIEKLLLVKEEGARGNRYAA--GDLSPFLLQLMTN 561 Query: 1093 KKPAIMLKDKSNGDLTSHKVSRYIWAQCLKANIVGPKCAALTKVIARSCKSLRFWLRQHY 1152 A+ + + R + + A + GP LT +++ CK+ + + HY Sbjct: 562 LFDALKFPESEENQYLMKCIMRVLGVADISAEVAGPCIGGLTSILSEVCKNPKNPIFNHY 621 Query: 1153 EWDSVASKKRK 1163 ++SVA R+ Sbjct: 622 LFESVAVLVRR 632 >At2g39300.1 68415.m04825 expressed protein ; expression supported by MPSS Length = 768 Score = 33.1 bits (72), Expect = 1.3 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 6/99 (6%) Query: 417 LMEMLFKLSRGIPFLSQILPYIKNNLEDSNTEQFELKQSVTACLENGTDCENLMKKIING 476 LM+ L KL + L Y++ N E+ + E EL +SVT L C+ K I Sbjct: 433 LMQNLSKLQESYTGSTDDLDYVRRNFEEKDMECKELHKSVTRLLRT---CKEQEKTIQGL 489 Query: 477 NDIFPEECVESYGKYT-SELMFRQNKEV-LEL-LQKDFE 512 D F EE + ++ +L Q + V +EL L+K+ E Sbjct: 490 RDGFSEEIKKQPSEHVDKKLQMEQLRLVGVELSLRKEVE 528 >At1g01960.1 68414.m00114 guanine nucleotide exchange family protein similar to guanine nucleotide exchange factor [Homo sapiens] GI:5456754; contains Pfam profile PF01369: Sec7 domain Length = 1750 Score = 33.1 bits (72), Expect = 1.3 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 5/79 (6%) Query: 369 DKATMNIIKTALKLDPTLIEQKLTVILPPIMTAKKHNAYKCYVDMLSCLMEMLFK-LSRG 427 ++ ++KTA + P + T +LPP A K A KC V +L + + + K L Sbjct: 494 ERMVNGLLKTAQGVPPGTV----TTLLPPQEAAMKLEAMKCLVAVLRSMGDWVNKQLRLP 549 Query: 428 IPFLSQILPYIKNNLEDSN 446 P+ +++L + NLE+ + Sbjct: 550 DPYSAKMLEIVDRNLEEGS 568 >At1g15660.1 68414.m01880 expressed protein similar to CENPCA protein (GI:11863170) {Zea mays} Length = 705 Score = 32.3 bits (70), Expect = 2.3 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Query: 558 SEDFWNAFDKFE---RECLKRFGECTLKLSYNPP 588 SEDF+ A+DKFE RE K+ G + + NPP Sbjct: 125 SEDFFAAYDKFELANREWQKQTGSSVIDIQENPP 158 >At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum] GI:7385017; contains Pfam profiles PF00201: UDP-glucoronosyl and UDP-glucosyl transferase, PF01535: PPR repeat Length = 1184 Score = 31.9 bits (69), Expect = 3.0 Identities = 42/163 (25%), Positives = 63/163 (38%), Gaps = 9/163 (5%) Query: 862 IINKENKALNSIEGFREPAFQISCIILPLIAKQKKALTTSAHRSILADLQDKLHRELLKA 921 +IN KA + + FR I P + + L + LH Sbjct: 870 LINGYCKAGHMKDAFRVHNHMIQAGCSPNVVTYTTLIDGLCKEGDLDSANELLHEMWKIG 929 Query: 922 FKNIDFVNGSFVKNI--SGNTENSMV---ESNAATLNA-MAAYTLTLSKYCEATKPDEAN 975 + F S V + SGN E ++ E AA LNA YT + YC++ + D+A Sbjct: 930 LQPNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGLNADTVTYTTLMDAYCKSGEMDKAQ 989 Query: 976 EM--ECVLKGLEFFVETSIRTIEEATSESQQIESSLGLLNVML 1016 E+ E + KGL+ + T + +E LLN ML Sbjct: 990 EILKEMLGKGLQPTIVT-FNVLMNGFCLHGMLEDGEKLLNWML 1031 >At5g50140.1 68418.m06210 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 535 Score = 31.5 bits (68), Expect = 4.0 Identities = 20/86 (23%), Positives = 41/86 (47%), Gaps = 2/86 (2%) Query: 639 WIDLMSKIKDEETIVLYKQIAKTLIKRYSNNSDAKLFNDVTISNNRVLLNYL--TLETVK 696 ++ L K+ +EE + +I +L+ + SD L + + +LL L T E+++ Sbjct: 30 FLHLAVKLGNEELVKKIVEIHPSLVSSTNTKSDTPLHLAARLGHTSILLLMLESTAESIE 89 Query: 697 QIAKCFDNADSLSKAISKIDFTKSFC 722 + + N L++ ++K FT C Sbjct: 90 SLEETVPNDLKLAEMVNKDGFTPLHC 115 >At3g25430.1 68416.m03162 CAF1 family ribonuclease contains Pfam domain, PF04857: CAF1 family ribonuclease Length = 618 Score = 31.5 bits (68), Expect = 4.0 Identities = 29/112 (25%), Positives = 53/112 (47%), Gaps = 7/112 (6%) Query: 849 KANNEIVKKLVELIINKENKALNSIEGFREPAFQISCIILPLIAKQKKALTTSAHRSILA 908 K + ++ K+ ++ + +EN+ + GFRE IS P++++ + TS H L Sbjct: 286 KEDKDLFKRELKDLEKEENRR---VRGFREVVDFISSSQKPVVSQNYLSDFTSIHAKFLG 342 Query: 909 DLQ---DKLHRELLKAFKNIDFVNGSFVKNISGNTENSMVESNAATLNAMAA 957 L D L AF N+ ++ F+K IS + S + + ++LN A Sbjct: 343 PLPSNVDDFSSSLSSAFPNVVDLS-QFMKEISPLSNISNLPAAMSSLNRFFA 393 >At5g52450.1 68418.m06508 MATE efflux protein-related strong similarity to unknown protein (pir||T02324); contains Pfam profile PF01554 Uncharacterized membrane protein family Length = 486 Score = 31.1 bits (67), Expect = 5.3 Identities = 17/53 (32%), Positives = 29/53 (54%) Query: 102 IPFILQFLGNTRITPQLNQHIDEYLKISITVLLCLKHEEQLNVTFVKQLISNI 154 IPF L +TRI+ +L + K+++ V++C+ E + + V LI NI Sbjct: 302 IPFGLSGAASTRISNELGAGNPKVAKLAVRVVICIAVAESIVIGSVLILIRNI 354 >At4g19900.1 68417.m02916 glycosyl transferase-related contains Pfam profiles PF01535: PPR repeat, PF04572: Alpha 1,4-glycosyltransferase conserved region, PF04488: Glycosyltransferase sugar-binding region containing DXD motif; several hypothetical proteins - Arabidopsis thaliana Length = 1302 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 7/116 (6%) Query: 446 NTEQFELKQSVTACLENGTDCENLMKKIINGNDIFPEECVESYGKYTSELMFRQNKEVLE 505 N++Q + A + + + KKI+N + F + TS L+ V + Sbjct: 577 NSQQITNYFAYPAIEDERSQQDESFKKILNESLTF-----HFWNSVTSSLIPEPESLVAK 631 Query: 506 LLQKDFEEHCLMMLEEGFVSPSIITIAEVLAAILSSFLRYNKMADHTVPFQISEDF 561 L+ D E L + SPS + V + + +S+LR N + + P +++ DF Sbjct: 632 LISSDHESSDLSLPSSPSSSPSQCLVKSVCSLVCTSYLRQNHVV--SSPHRVNLDF 685 >At3g22220.1 68416.m02803 hAT dimerisation domain-containing protein contains Pfam profiles PF04937: Protein of unknown function (DUF 659), PF05699 hAT family dimerisation domain Length = 761 Score = 30.7 bits (66), Expect = 7.0 Identities = 16/46 (34%), Positives = 23/46 (50%) Query: 448 EQFELKQSVTACLENGTDCENLMKKIINGNDIFPEECVESYGKYTS 493 E E ++VT + N + NLM+K GNDI C S +T+ Sbjct: 373 EIIEQARTVTRIIYNHSGVLNLMRKFTFGNDIVQPVCTSSATNFTT 418 >At5g50840.1 68418.m06298 expressed protein Length = 404 Score = 30.3 bits (65), Expect = 9.3 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 10/111 (9%) Query: 438 IKNNLEDSNTEQFELKQSVTACLENGTDCENLMKKIINGNDIFPEECVESYGKYTSELMF 497 IK LE E+ E ++ L G+ + + K ++ +E VES K S+ MF Sbjct: 77 IKLELEFEQKEK-EASPPISQTLSEGSTQNSTLSKEMDSLKPKKQEVVESKRK-GSKNMF 134 Query: 498 RQNKEVLELLQKDFEEHCLMMLEEGFVSPSIITIAEVLAAILSSFLRYNKM 548 + KE LE + K +++ +L E S IT+ + L ++ R NKM Sbjct: 135 KSEKEFLEFMLK-YQQ----VLSE---RDSAITVRDKLESLCRELQRQNKM 177 >At5g28350.2 68418.m03443 expressed protein Length = 1087 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Query: 987 FVETSIRTIEEATSESQQIESSL-GLLNVMLRHIKK-LDTHEMFKEKDKLFSGIWRSLKT 1044 F+ S R IE+A +ES + L G L H K LD FKE+ + + L++ Sbjct: 883 FLLRSGRDIEQAPTESDSLSPKLLGFLIFGSSHKKSSLDKSSSFKEQSPHVASVKSILES 942 Query: 1045 RLSIVFSGK 1053 S + SGK Sbjct: 943 HASYLMSGK 951 >At5g28350.1 68418.m03442 expressed protein Length = 1127 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Query: 987 FVETSIRTIEEATSESQQIESSL-GLLNVMLRHIKK-LDTHEMFKEKDKLFSGIWRSLKT 1044 F+ S R IE+A +ES + L G L H K LD FKE+ + + L++ Sbjct: 923 FLLRSGRDIEQAPTESDSLSPKLLGFLIFGSSHKKSSLDKSSSFKEQSPHVASVKSILES 982 Query: 1045 RLSIVFSGK 1053 S + SGK Sbjct: 983 HASYLMSGK 991 >At5g10100.1 68418.m01170 trehalose-6-phosphate phosphatase, putative similar to trehalose-6-phosphate phosphatase (AtTPPB) [Arabidopsis thaliana] GI:2944180; contains Pfam profile PF02358: Trehalose-phosphatase Length = 369 Score = 30.3 bits (65), Expect = 9.3 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 8/99 (8%) Query: 694 TVKQIAKCFDNADSLSKAISKIDFTKSFCKKIDMKEYFLNITIPTENFDTIKNYIELL-- 751 TVK++AKCF A + I K+ + + ++I P + F K + L Sbjct: 142 TVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGSHGMDIKGPAKGFSRHKRVKQSLLY 201 Query: 752 --KNLQVPYLDENYQLAVIFVLLATKRNAGKKLRRNTDC 788 N +P +DE Y+ +L TK G K+ + C Sbjct: 202 QPANDYLPMIDEVYRQ----LLEKTKSTPGAKVENHKFC 236 >At3g61480.1 68416.m06885 expressed protein Length = 1091 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Query: 987 FVETSIRTIEEATSESQQIESSL-GLLNVMLRHIKK-LDTHEMFKEKDKLFSGIWRSLKT 1044 F+ S R IE+A +ES + L G L H K LD FKE+ + + L++ Sbjct: 888 FLLRSGRDIEQAPTESDSLSPKLLGFLIFGSSHKKSSLDKSSSFKEQSPHVASVKSILES 947 Query: 1045 RLSIVFSGK 1053 S + SGK Sbjct: 948 HASYLMSGK 956 >At3g29410.1 68416.m03695 terpene synthase/cyclase family protein similar to terpene synthase GB:CAA72074 from [Arabidopsis thaliana], contains Pfam profile: PF01397 terpene synthase family Length = 603 Score = 30.3 bits (65), Expect = 9.3 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 7/100 (7%) Query: 571 ECLKRFGECTLKLSYNPPLVL--SFLKLCVSFAQLKLLNIKYS--NYKLKIETSTSETFD 626 E K FG TL + +N PL L +F Q + L+ K S +Y +++ TS + Sbjct: 2 EASKCFGPRTLPIIHNVPLCLKTNFSLFPCRLLQSQSLSSKKSTKHYLFRVKAETSGDLE 61 Query: 627 MSSILPCLNSAQWID--LMSKIKDEETIVLYKQIAKTLIK 664 + L + + W D L I D E L K+I +T+ K Sbjct: 62 STRPLTYFSPSYWGDHFLSVSIDDSEFEALEKEI-ETVFK 100 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.321 0.135 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,393,735 Number of Sequences: 28952 Number of extensions: 1174025 Number of successful extensions: 3399 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 13 Number of HSP's that attempted gapping in prelim test: 3392 Number of HSP's gapped (non-prelim): 21 length of query: 1364 length of database: 12,070,560 effective HSP length: 90 effective length of query: 1274 effective length of database: 9,464,880 effective search space: 12058257120 effective search space used: 12058257120 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -