BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000127-TA|BGIBMGA000127-PA|IPR002478|PUA (180 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 3.0 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 4.0 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 21 5.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.0 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 9.2 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 9.2 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 9.2 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 9.2 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 9.2 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 9.2 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 9.2 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 9.2 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 9.2 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 9.2 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 9.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 9.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 9.2 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.2 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 3.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 104 EQQFLYGHHIIKSGLGRITEN 124 EQ+ L G+H I G R EN Sbjct: 283 EQRILSGYHAIAGGQQRPDEN 303 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 4.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Query: 40 KKDRVYYISEKLLHLAQTVKPDNLVSAGTCFGKFT 74 +KD Y+S + L A L+S G GK T Sbjct: 105 QKDNKSYLSLRSLLSADVAVATPLISMGALLGKTT 139 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/26 (26%), Positives = 16/26 (61%) Query: 97 VWVKPSAEQQFLYGHHIIKSGLGRIT 122 V+ + + E++ Y H++K GR++ Sbjct: 41 VFCRNNGEEEAYYRKHLLKDADGRVS 66 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 104 EQQFLYGHHIIKSGLGRITENTPK 127 +Q ++ ++ LG++TE PK Sbjct: 657 QQMTVFQRTLMVGSLGKLTETNPK 680 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 145 IPRFRYIGPSTPFPRFIPPNA 165 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 153 IPRFRYIGPSTPFPRFIPPNA 173 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 153 IPRFRYIGPSTPFPRFIPPNA 173 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 145 IPRFRYIGPSTPFPRFIPPNA 165 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 145 IPRFRYIGPSTPFPRFIPPNA 165 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 145 IPRFRYIGPSTPFPRFIPPNA 165 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 145 IPRFRYIGPSTPFPRFIPPNA 165 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 145 IPRFRYIGPSTPFPRFIPPNA 165 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 145 IPRFRYIGPSTPFPRFIPPNA 165 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 145 IPRFRYIGPSTPFPRFIPPNA 165 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 145 IPRFRYIGPSTPFPRFIPPNA 165 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 361 IPRFRYIGPSTPFPRFIPPNA 381 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 372 IPRFRYIGPSTPFPRFIPPNA 392 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 378 IPRFRYIGPSTPFPRFIPPNA 398 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 83 ITALTYISPYAPFKVWVKPSA 103 I YI P PF ++ P+A Sbjct: 378 IPRFRYIGPSTPFPRFIPPNA 398 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 20.6 bits (41), Expect = 9.2 Identities = 6/26 (23%), Positives = 15/26 (57%) Query: 133 VLTMSDIPIGFGVASRTTAECRHADP 158 ++ +++IP +G+ A+C +P Sbjct: 48 LIKLNNIPKSYGIKCEIYAKCEFLNP 73 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.138 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,826 Number of Sequences: 429 Number of extensions: 2027 Number of successful extensions: 20 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of query: 180 length of database: 140,377 effective HSP length: 54 effective length of query: 126 effective length of database: 117,211 effective search space: 14768586 effective search space used: 14768586 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -