BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000126-TA|BGIBMGA000126-PA|undefined (179 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 25 0.27 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 5.8 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 21 5.8 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 25.4 bits (53), Expect = 0.27 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query: 9 VGEHLNNLDTVALETDSEEVKSRKRVRRQLKSMAPCINLIMKEILEKKFLSVRN 62 +GE L + + + +E ++RK M P + ++ EI EK LS+RN Sbjct: 40 IGEILQQIMNIT-DQSLDEAQARKHTLN-CHRMKPALFSVLCEIKEKTVLSLRN 91 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 5.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 66 RIKIYGEPFLPSKE 79 RI +YG PF+ S E Sbjct: 505 RINVYGLPFVRSME 518 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 21.0 bits (42), Expect = 5.8 Identities = 9/29 (31%), Positives = 17/29 (58%) Query: 22 ETDSEEVKSRKRVRRQLKSMAPCINLIMK 50 ET S++ K + ++LK M CI +++ Sbjct: 28 ETFSDDTKPDYKSLQELKYMERCIKEVLR 56 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,534 Number of Sequences: 317 Number of extensions: 665 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 179 length of database: 114,650 effective HSP length: 53 effective length of query: 126 effective length of database: 97,849 effective search space: 12328974 effective search space used: 12328974 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -