BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000124-TA|BGIBMGA000124-PA|IPR002048|Calcium-binding EF-hand (103 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 23 1.7 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 21 6.9 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 31 LATENKEATGNVPLTNFLPYMCKVMIEHRFYPASAE 66 +A +++ TGNVP+ +FL ++ +P E Sbjct: 131 VALVHRKDTGNVPVPSFLEMFPTRFVDPALFPKLVE 166 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Query: 1 MVNFEYSKRDVKYMFFKGCCPTEAEIQEV 29 +V + SK +++GC T A+ QE+ Sbjct: 169 VVQHDLSKYPAISAWYEGCKATMADFQEI 197 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.137 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,298 Number of Sequences: 2123 Number of extensions: 3482 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 103 length of database: 516,269 effective HSP length: 55 effective length of query: 48 effective length of database: 399,504 effective search space: 19176192 effective search space used: 19176192 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -